KEGG   Apis mellifera (honey bee): 411553
Entry
411553            CDS       T01057                                 

Definition
(RefSeq) protein bunched, class 2/F/G isoform isoform X1
Organism
ame  Apis mellifera (honey bee)
SSDB
Motif
Pfam: TSC22 K-box Fzo_mitofusin HlyD_2
Other DBs
NCBI-GeneID: 411553
NCBI-ProteinID: XP_006566767
BEEBASE: GB44883
AA seq 701 aa
MADNVHRKSHKLSDGSRKISNPVHRTTTETIRLGEPEKLYQPVSLTTSSNVTATNQCRKK
TSSFQITSVTVGSRMSNDAGEDSNDDLDESHTEDNSVEHSRITDIDIETPSYSEDTFSKE
DVFFNTSNAALSTAPVIPTSSQYGLAIVPSEGNNVSNSVNDSNINTLDITSVTDNNIINL
LSSNVKQDADLREVHSHGRNERFKVVKIESTEPFKRGRWTCMDYLDHTSVNQPTAISTPK
VSDPNEVCISYGVTDSGIVIPDAPKQSIVSEDKGMGIDTNGQVSAHADVHTSIGVPNNST
SVSSANYAVSNSIPPNAQHNPTQVQTQTNVQAPSQIPQYFQSSAQQLASQQQQQSGQGST
LPSNLQPTHPNNLTQPQSMPQGSIPIITQTGSSNVTSQQNIPHSKEDTYVTVSTQNQSLP
VQNVCQPSVQQTPVPTSQAPNILVSQQQQHAPQQQQQQHPQNQQQQQPQQQQQPQQSIPN
PKTMTQISEPLTAIQGMQSIQNIHKVPQTGAQQTSSTIHAPGAPVQSQVIPSSQIQPTTS
GSNTQVQMAQVSASCQNVVGGIQQGNITFHQPDPEQDSISGIVAGSTTQSADTTLLESLT
EVTQGSDEHHTLEDNESMSGTSAVAIDNKIEQAMDLVKSHLMFAVREEVEVLKEKIAELM
DRINQLEAENSILKAHATPETLAQLNQSTAKLPQNNSGSGQ
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggcagataatgtacacagaaaatcccataagctatcggatggtagtagaaaaatatcg
aatccagtgcatcgtacaactactgagacgattcggttaggagagccagagaaactgtat
cagccggttagtttgactacttcgagcaacgtgacggccactaaccagtgtcggaaaaag
acatcgtctttccagattacaagcgttactgttggttctcgtatgagcaatgatgccggt
gaagattcaaatgatgatcttgatgaatcgcatacggaggacaattcggtcgaacattcg
cgtatcaccgacattgacattgaaacgcctagctattcagaagatactttctccaaagag
gatgtattttttaataccagtaatgctgccctcagcactgctccggtgattcctacaagt
tctcagtatggtttggcaattgttccctctgaaggaaataatgtcagtaattcggtaaat
gatagcaatatcaataccttggatattacatctgttaccgacaacaacattatcaattta
ctttcaagtaatgttaaacaagatgcagatttacgtgaagtacattcacatggtagaaat
gagagatttaaagttgttaagattgaaagtactgaaccatttaaaaggggcagatggact
tgcatggattatttggatcatacatcagtcaatcaaccaacagcaatcagtacaccaaaa
gtatcagatccaaatgaggtatgcatatcatatggagtaacagatagtggaattgttata
cctgatgcacctaaacaatcaattgtatcagaagataaaggtatgggcattgatactaat
ggacaagtatctgcacatgcagatgtgcatacatcaattggtgtaccaaataattctaca
tcagtttcaagtgctaattatgcagtaagcaattcaattcctcccaatgcacagcataat
ccaacgcaagttcaaacacaaactaatgttcaggcaccttcgcaaattcctcaatatttt
caatcttcagctcaacaattggcatctcaacaacaacagcaaagtggccagggttccaca
ttaccttctaatctacaaccaactcatcccaataatttgactcaacctcaaagtatgccc
caaggttctattcctattataacacaaactggtagtagcaatgtaacatctcaacaaaat
atacctcattcaaaagaagatacatatgtgacagtgagcacacaaaatcaatcattacca
gtccaaaatgtttgtcaaccttctgtgcagcaaacacctgtaccaacatcacaggcacct
aatattctagtttcgcaacaacaacaacatgctcctcaacaacagcaacaacaacatcct
caaaatcaacagcaacaacaaccacagcagcagcaacaacctcaacaatcaatacctaat
ccaaaaacaatgactcaaatatctgagccattgactgccatacaaggaatgcagagcatc
caaaatattcataaagttcctcaaacaggtgcacaacaaacatcatcaactattcatgct
cctggtgcaccagtacaatctcaagtgataccatcatctcaaatacaaccaacaacttct
ggtagtaatactcaagtacaaatggcacaagtatcagctagctgccaaaatgttgtaggt
ggtatacaacagggaaatataacatttcatcaaccagatccggagcaggattctatttca
gggattgtagctggatccactacccaatctgctgatactactcttttagaatcattaacc
gaagtgactcaaggcagtgatgaacatcataccctcgaagataatgaaagtatgtcgggg
actagcgctgtagcaattgataataagattgagcaagccatggatcttgttaagagtcat
ttgatgtttgctgtacgagaagaagttgaagtactcaaggaaaaaatagctgagcttatg
gatcgtataaatcaattggaagctgaaaattcaattctgaaagcacacgcgactccagaa
acattggctcaattgaaccaatcaacagcaaaattaccccaaaacaattcaggaagtggt
caatag

DBGET integrated database retrieval system