KEGG   Apis mellifera (honey bee): 411599
Entry
411599            CDS       T01057                                 

Name
(RefSeq) uridine phosphorylase 1 isoform X2
  KO
K00757  uridine phosphorylase [EC:2.4.2.3]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00240  Pyrimidine metabolism
ame00983  Drug metabolism - other enzymes
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    411599
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    411599
Enzymes [BR:ame01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.3  uridine phosphorylase
     411599
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-GeneID: 411599
NCBI-ProteinID: XP_006562637
BEEBASE: GB43285
UniProt: A0A7M7GRP7
Position
LG7:7967174..7995245
AA seq 340 aa
MSLLLEEEEIDEYRDGSVRLRNPNIELMDQDILYHLALGSGSHDLVEMFGDVKFVCMGGT
PKRMEQFANYIMKEIGHKLPAGTTLLDISQYSYRYSMYKVGPVLSISHGMGIPSVGILLH
EVIKLMYHAKVKDPIFFRIGTCGGIGLEGGTVVISEEAVDGMLKSYLELPVLGKMVRRPA
KLDRQLARDLKTLAHRDNPYDTIIGKTMCTYDFYEGQGRMDGAFCEFTENEKIEYLNKLH
KAGVINIEMESLAFAALTHHAGIKAAVVCVTLIDRFKGDQVLAPKEVLDEWQIRPQELIA
RYITRYLQRKGRLSLEGHGSMCVKSPRRFKLVQQESENYD
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagtcttctgctagaagaggaagaaattgacgaatacagagatggatccgtgcgactt
cgaaacccaaacattgagcttatggatcaagatatactatatcatcttgctttgggcagt
ggttcccacgatctcgttgaaatgtttggagatgtcaagtttgtgtgtatgggaggaacg
ccaaagcgtatggaacaattcgctaattacataatgaaggaaataggtcataaacttcca
gctggaacaacacttcttgatattagccaatattcatatcgttattccatgtataaagtt
ggaccggttctttctattagtcatggaatgggcataccatcggttggaattttgcttcac
gaagtgattaagctgatgtaccatgcaaaggtgaaagatccaatattcttcaggattggt
acatgcggaggaattggccttgaaggtggcactgtcgtcatttctgaggaagcagtcgat
ggaatgctgaagtcttatttggaactgcctgtgcttggtaaaatggtaagaagacctgct
aaactagatagacaattggctcgtgatttgaagacactagcacatcgtgacaatccttat
gacactataatcggtaaaacgatgtgtacttatgacttctacgaaggacaagggcgaatg
gacggtgcattttgcgaattcacggaaaatgaaaaaatagagtacttaaacaagctgcat
aaagctggcgtaataaatatagaaatggagagtcttgcatttgctgctcttacacatcat
gcaggcatcaaagctgctgttgtttgtgtaacattgatagatcgattcaaaggagatcag
gtattagcaccaaaagaagttctggacgaatggcaaataagaccgcaagaattaatcgca
cgctatataacgagatatcttcaacgaaaaggccgcctttccttagaaggtcatggatcg
atgtgtgtcaagagtccacgtcggtttaaattggtacaacaggagtcggaaaactatgat
taa

DBGET integrated database retrieval system