KEGG   Apis mellifera (honey bee): 411627
Entry
411627            CDS       T01057                                 

Definition
(RefSeq) retinoblastoma-like protein 1 isoform X2
  KO
K04681  retinoblastoma-like protein 1
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    411627
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ame03000]
    411627
Transcription factors [BR:ame03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    411627
SSDB
Motif
Pfam: RB_A RB_B DUF3452 TFIIB Fumerase
Other DBs
NCBI-GeneID: 411627
NCBI-ProteinID: XP_006570247
BEEBASE: GB45686
AA seq 1039 aa
MGQSDDVEDSTYSRHQDLCQKLNMDATAASEAWKSYETIRQNYTLEGDQLHWIGCALYVA
CRKSSIPTVGKTGTNVEGNCVSLTRLLQLCNLPLIQFFTKSKSWADMANMPQDFRSKIEK
LEGNFAVSMVIFKKYQPIFTDIFKDPVDDISRPPRSRRHKAMPCTPARVFEFCWTLFICI
KGAFPDISDDLVNSYHLLLVCCDLIYSNALLANRKDLLNPNFPGLPSNFNDENYTPPQTA
NCIVSLLCERHEAIAVEAKVIKEYYLKNHINKLFNERVLRGDQSNFSGILEALNFDGNSK
AINRVYEQHVLSVGDFDERIFLADWRRVRLNGISSLEIVGGDLACHARLSKHIFIRGHDA
SNNIGSPTQMMNVGDLHEQFQMKKEQNSGIQHLAPTTPLTGRSYLRQKDITNVTPVSTAT
QSVIRLQAMLAGQTSPSENLLQILNNCSQDVKTLVETKVKELGEQFCANYNRSTNANETT
SDFGRKRLYLGQTLFYRLLEMILNDEKRKKPNYDVTNLLTKEIFIQCLFACCLEIVIYSY
KSNDKIFPWILNALNLDAYYFYKVIEIIVRAEDQLSRDVVKHLNQIEEKILESLAWQSDS
PLWNAIQSTPEGVPSCEEVSLPGMLETVDPNIPGQPVLRRIALDRGTHHDVQQSPISSAS
ERFQSPVAASGVAKKRLFSDTRIGGQSVLRGTGQSVLPSKVLTIDSNSRILFLPEQITVP
RSSSVQTTAAPIQTVTINRESAKPKRTGSVALFFRKFYNLASVRMLDLCGSLEIMDIDLK
KKIWTIFEYSIKERTELMKDRHLDQILMCAIYVICKLVKMEKNSFTEIMRCYRLQPQAES
HIYRSVLIAKTPSGESQKNNEEIKQKDVSDKETNVAPPTPTNMAGTSQNFGEETRGDLIK
FYNTVYVPQVKEMANKFGLVRGSVMNLSLSPLPKGKPPANSPVRRVTSSIMTRTLDPKAI
SASPAPQLSYCFSRSPAKDLEAINKMMISVDPKRSVGKRLLSDDTDVEMSEGTSPIKKTT
AFVARKLENIIGERRTQNQ
NT seq 3120 nt   +upstreamnt  +downstreamnt
atgggacagtcagatgatgtagaagattctacttatagtagacatcaagatttgtgtcag
aaattaaatatggatgcaactgctgcatctgaagcttggaaatcttatgagactattcga
caaaattatactcttgagggtgatcaattacattggatagggtgtgcattatatgtagct
tgtcgtaagtcttctatacctactgttggaaaaactggtactaatgtggaaggcaattgt
gtttcattgacacgtttattacaattgtgtaatcttcctttaatacaattttttacaaaa
agtaaatcttgggctgatatggctaatatgccacaagattttcgttcaaagattgaaaaa
ttagaagggaattttgctgtttctatggttatattcaaaaagtatcagccaattttcact
gatatatttaaagatcctgtagacgatatttcaagaccaccaagatctagaagacacaaa
gcaatgccttgcacacctgcaagagtatttgaattttgttggactttatttatttgtata
aaaggagcatttccagatatttctgatgatttggttaattcgtatcatcttcttttagta
tgttgtgatcttatatatagcaatgctttattggctaatagaaaggatcttttaaatcct
aattttcctggtttaccatcaaatttcaatgatgagaattacactccaccacagacagca
aattgtatagttagcttattatgtgaacgtcatgaggctattgcagttgaagctaaagta
attaaggaatattatttgaagaatcatattaataaattgttcaatgaaagagttttacgg
ggtgatcagtcaaacttttctggtattttagaagctctcaattttgatggcaatagcaaa
gctatcaatagagtttatgaacaacatgtattaagtgttggagactttgatgaaaggatt
ttcttagctgattggaggagagtgagattaaatggaatatcaagtttggaaatagttgga
ggagatctagcttgtcatgctagattatctaaacatatttttataagaggccatgatgct
agtaataatattggatctcctacacagatgatgaatgttggtgatcttcatgaacaattt
caaatgaaaaaagaacaaaatagtggaatacaacatttagctccaactactccattaact
ggacgtagttatcttagacaaaaagatattactaatgtgacaccagtatccacggcaaca
caaagtgtaattagactccaagctatgttggcaggtcaaacttcaccaagtgaaaatttg
ttacaaattttaaataattgttctcaagatgtaaaaactcttgttgaaacaaaagttaaa
gaacttggcgaacaattttgtgctaattacaacagaagtacaaatgcaaatgagactact
tcagattttggaagaaaaagactttatttaggtcaaactcttttttatcgacttttagaa
atgattttaaatgatgaaaaacgcaagaaaccaaattacgatgtaacgaatcttcttaca
aaagaaatttttattcagtgcttatttgcctgttgtctagaaatagtcatttattcatac
aaaagtaatgacaaaatttttccttggattctaaatgctctgaatttagatgcgtattat
ttctataaagtaatagaaattatagttagagcagaagatcaattatcccgtgatgttgta
aagcatttaaaccaaatagaggaaaagattttagaatcacttgcatggcaaagtgacagt
cctttatggaatgctatacaatctacaccagaaggtgttccaagctgtgaagaagtttcc
ttgcctggcatgttagaaactgttgatccaaatattccaggacaacctgtattaagaaga
attgctttagatcgtggcactcatcatgatgtacaacaaagtcctatttcctcagcctct
gaaagatttcaatctcctgtcgcagcatctggtgtagctaaaaaacgactattttcagat
accagaattggtgggcaaagtgttttgcgaggaacaggtcaaagtgtcttaccatcaaaa
gttctaactatcgatagcaattcgagaatactttttttaccagaacaaattacagttcca
agatcgtctagtgtacaaacgacggctgcaccaatacaaactgtaacaattaatagagaa
tcagcaaaaccaaaacgaaccggttctgttgcattatttttcagaaaattttataatcta
gctagcgtacgtatgctagacttatgtggatcgttagaaataatggatattgatttaaaa
aaaaagatatggacaatttttgaatattccattaaagaacgaacagaattaatgaaagat
cgtcatctagatcaaattttaatgtgtgcaatttatgtaatatgcaagttggtaaaaatg
gaaaagaattcgtttactgaaatcatgcgatgttaccgattacaaccacaagcagaatct
catatatatagatcagtacttatagccaaaacaccatccggtgagtcacaaaagaacaac
gaagaaattaaacaaaaagatgtatcggacaaagaaactaatgtagcacctcctacacct
acgaatatggctggtacttcgcagaatttcggtgaagaaacacgtggtgatttaataaaa
ttttataatacagtatatgtaccacaagtaaaagaaatggcaaataaatttggattagta
cgcggtagtgtaatgaatctgtcattgagtccacttccaaaaggaaaacctcctgcaaat
tcaccagtgagacgtgttactagtagtattatgacgcgtacattagatccgaaagctatt
tcagcttctccagcaccacaacttagttattgctttagtcgtagccctgcaaaggatttg
gaggctattaataaaatgatgatttccgtcgatccaaaaagatccgttggcaagcgactt
ttatcggatgatacggacgtggagatgtcagaaggaacatccccgatcaaaaagacaact
gcattcgttgcacgtaaattagaaaatataattggtgaacgacgtacgcaaaatcaataa

DBGET integrated database retrieval system