KEGG   Apis mellifera (honey bee): 411700
Entry
411700            CDS       T01057                                 

Name
(RefSeq) heat shock protein 83
  KO
K04079  molecular chaperone HtpG
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    411700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ame01009]
    411700
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ame03110]
    411700
   04131 Membrane trafficking [BR:ame04131]
    411700
   03051 Proteasome [BR:ame03051]
    411700
   03029 Mitochondrial biogenesis [BR:ame03029]
    411700
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ame04147]
    411700
Protein phosphatases and associated proteins [BR:ame01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     411700
Chaperones and folding catalysts [BR:ame03110]
 Heat shock proteins
  HSP90
   411700
Membrane trafficking [BR:ame04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    411700
Proteasome [BR:ame03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    411700
Mitochondrial biogenesis [BR:ame03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    411700
Exosome [BR:ame04147]
 Exosomal proteins
  Proteins found in most exosomes
   411700
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 LOH1CR12
Other DBs
NCBI-GeneID: 411700
NCBI-ProteinID: XP_006571335
BEEBASE: GB45495
Position
LG1:complement(20112796..20115650)
AA seq 718 aa
MSTEMETKAEDVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLT
DPSKLDNGKELFIKIIPNKNDGTLTIIDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLIADKVTVISKHNDDEQYLWESSAGGSFTVRHDNGETLGRGTK
IVLHVKEDQAEYLEESKIKEIVKKHSQFIGYPIKLVVQKEREKELSEDEAEEEEEEKKED
DGKPKIEDVDENEEAPEEEGKKKKKKTIKEKYTEDEELNKTKPIWTRNSDDITQEEYGEF
YKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPKRMPFDLFENKKRKNNIKLYVRRVFIMD
NCEQLIPEYLNFIKGVVDSEDLPLNISREMLQQNKILKVIRKNLVKKCIELFEELAEDKD
NYKKFYEQFSKNIKLGIHEDSSNRNKLSDLLRYHTSSSGDEVCSLKDYVGRMKENQKHIY
FITGESKDQVANSSFVERVKKRGFEVVYMTEPIDEYVVQQMKEFDGKQLVSVTKEGLEFP
EDEDEKKKREEDKAKYENLCKVMKNILDNKVEKVVVSNRLVDSPCCIVTSQYGWTANMER
IMKAQALRDTSTMGYMAAKKHLEINPDHTIIETLHQKAETDKNDKAVKDLVILLFETALL
SSGFTLDEPQVHAARIYRMIKLGLGIDEEESVSEEQTTEEIPPLEGDTEDSSRMEEVD
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgtcaacagaaatggaaacaaaagcagaagatgtggaaacttttgcattccaggcagag
attgctcaacttatgtcattgattattaataccttttattcaaataaagaaattttttta
agagaacttatatcaaactctagtgacgcccttgataagattcgttatgaatctttaact
gatccttctaagcttgataatggcaaagaattatttattaaaattattccaaacaagaat
gatggtactttgactattattgatactggtattggtatgactaaggctgatttggtaaat
aatcttggtacaattgcaaagtctggtaccaaagcttttatggaagcacttcaagctggt
gcagatatttccatgattggacaatttggtgtaggtttttattctgcttatttaatagca
gacaaagtcactgttatttcaaaacacaatgatgatgaacaatatctatgggaatctagt
gctggtggatcatttactgttagacatgataatggagaaacattaggacgaggaacaaaa
attgttttacatgtaaaagaagatcaagccgaatatttagaagagagtaaaataaaagaa
attgtaaaaaaacattctcaatttattggttatccaattaaattagttgtacagaaggaa
cgtgaaaaagaactgagtgaggatgaagctgaagaagaagaagaagagaaaaaggaagat
gatggaaaaccaaaaattgaagatgtagatgaaaatgaagaagcaccagaggaagaagga
aaaaagaagaagaaaaaaactattaaagagaaatatacagaagatgaagaattaaacaaa
acaaaacctatctggactagaaattctgatgatattacacaagaagaatatggtgaattt
tataaatcattgacaaatgattgggaagatcatttggctgttaaacatttttctgtagaa
ggtcaattagaattcagagctttactttttattccaaaacgtatgccatttgatttattt
gaaaataagaaaaggaaaaataatattaaattatatgtaagaagagtattcattatggac
aactgtgaacagttaattccagaatatttaaatttcataaaaggagtagttgatagtgaa
gatcttcctttgaacatttctcgtgaaatgcttcaacaaaataaaattttaaaggttatt
cgtaaaaatcttgtaaaaaaatgcatagaattgtttgaagaacttgcagaagacaaagat
aattataaaaaattctatgaacaatttagcaaaaacattaaattaggtattcatgaggac
agttctaatcgtaataaattatctgatcttttaagatatcacacttcatcttctggagat
gaggtctgttctcttaaggattatgtaggtagaatgaaagagaatcaaaaacacatttac
ttcattactggagagagcaaagaccaagttgcaaacagttcatttgttgaacgtgtaaaa
aaacgtggctttgaagttgtttatatgacagagcctatcgatgaatatgtagtacaacaa
atgaaagaatttgatggaaaacaattagtatctgtaaccaaagaaggtttagagtttcct
gaagatgaagatgaaaagaagaaaagagaagaagacaaagccaaatatgaaaatttatgt
aaagtaatgaaaaatattcttgacaataaagtagagaaagttgtagtttcgaatcgattg
gttgattcaccttgctgtatagttacttcacaatatggttggactgctaatatggaaaga
attatgaaagctcaagcacttagagacacatctactatgggatatatggctgcaaaaaaa
catcttgagataaatcctgaccatactattattgaaactttacatcagaaagcagaaaca
gataaaaatgataaagcagtaaaagatttagtaattttattgtttgaaacagcactttta
tcttctggttttactttagatgaaccacaagttcatgctgcaagaatttacagaatgatt
aaattgggacttggtattgatgaagaagaatctgtatcagaagaacaaactacagaagaa
attcctcctctggaaggagatacagaagatagttcacgaatggaagaagtagattag

DBGET integrated database retrieval system