KEGG   Apis mellifera (honey bee): 411816
Entry
411816            CDS       T01057                                 
Name
(RefSeq) cytoplasmic dynein 1 light intermediate chain 1 isoform X2
  KO
K10416  dynein cytoplasmic 1 light intermediate chain
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    411816
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ame04131]
    411816
   03036 Chromosome and associated proteins [BR:ame03036]
    411816
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ame04812]
    411816
Membrane trafficking [BR:ame04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    411816
Chromosome and associated proteins [BR:ame03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      411816
Cytoskeleton proteins [BR:ame04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     411816
SSDB
Motif
Pfam: DLIC ABC_tran G-alpha AAA_29 PduV-EutP Roc AAA_24 Arf
Other DBs
NCBI-GeneID: 411816
NCBI-ProteinID: XP_006561380
BEEBASE: GB47599
UniProt: A0A8B6YVK9 A0A7M7GS31
Position
LG16:5279085..5282690
AA seq 472 aa
MAATAIDMMLQSNGFHSKKKEDPENKDNLWSSILAEVQNSSSNKLPSNKNILVLGDNESG
KTTLIAKLQGVEDPKKGSGLEFAYIDVRDDYRDDQTRLSVWVLDGDPGHANLLRFALNAE
RFPHTLVMLVAAMTTPWAILDQLQSWAALLGDHIDKLPLDNDTWQRCRQLNVKKWQDYTE
PGDELDPGSPLRRTSRNLDDDTMDNLPLPEGVLTTNLGLDVVVVITKTDYMSTLEKEHDY
KDEHFDFIQQWIRRFCLQYGAGLFYTSAKEDKNCDLLYKYLTHRIYSLPFRTPALVVEKD
AVLIPAGWDNMKKISILHENLQSMKPDDYYRDVIAQPSINRKCVAREVEVQAEEEQAFLA
KQQAALLGVKDPTRSPTTRNQVASPNKKLDPKGTGSTQSGEGVLANFFNSLLHKKTGSPG
SPVGSGIGTSPIKIDSASVDKATMCNDAAVELDRLTRTKKISPPNLNSSSEC
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggcagcgacagcaattgatatgatgttgcaaagtaatggatttcattcaaaaaaaaaa
gaggatccagaaaataaagataatttatggtcctctattttggctgaagtacaaaacagt
agcagtaataaattaccctcaaataagaatattcttgtcttaggtgataatgaaagtgga
aaaacaacacttattgccaaattacaaggtgtggaagatccaaagaaaggttctggtttg
gaatttgcatacattgatgtgagagatgattatagagatgatcaaacaagattatctgtt
tgggtattggatggcgatcctggtcatgcaaatcttttaagatttgcattaaatgcagaa
agatttccacatacccttgttatgttagttgctgcaatgacaacaccatgggctattttg
gatcaacttcaatcttgggctgctcttttaggagatcatattgacaaattacctttagat
aatgatacttggcaacggtgtaggcaattaaatgtaaagaaatggcaagattatacagaa
cctggagatgaattagatccaggtagtcctttaagacgtactagtcgtaatttggatgat
gatacaatggataacttaccattaccagaaggagtacttacaacaaatttgggattagat
gttgttgttgttattacaaaaactgattatatgtccacgcttgaaaaagaacatgattac
aaagatgaacattttgattttatacaacaatggataagacgattttgtttacaatatggt
gcaggattattttacacatcagcaaaagaagataaaaattgtgatttgctttataaatat
cttacacatagaatttattcattaccatttagaacacctgctttagttgttgaaaaagat
gcagttcttattcctgctggttgggataatatgaaaaaaattagcattcttcatgaaaat
ttgcaatcaatgaaaccagatgattattatagagatgttattgcacaaccatcaataaat
agaaagtgtgtagctagagaagtagaagtacaagcagaagaagaacaagctttcttggca
aaacaacaagctgcattattaggtgtaaaagatccaacgcgttctccaacaaccaggaat
caggtagcatcaccaaataaaaaattagatcctaagggtactggatctacacaatctgga
gaaggtgttttagctaatttcttcaattctcttcttcataaaaaaactggaagtcctgga
tcaccagttggtagtgggattggtacaagtcccataaaaattgatagtgcatcagtagat
aaagcaactatgtgtaatgatgcagcagtggaattagatcgcctcactcgaacgaaaaag
atttctcctcctaatttaaattcatcatctgaatgttaa

DBGET integrated database retrieval system