KEGG   Apis mellifera (honey bee): 412008
Entry
412008            CDS       T01057                                 

Definition
(RefSeq) sprouty-related, EVH1 domain-containing protein 1 isoform X2
  KO
K04703  sprouty-related, EVH1 domain-containing protein
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ame01009]
    412008
Protein phosphatases and associated proteins [BR:ame01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     412008
SSDB
Motif
Pfam: Sprouty WH1 Ribosomal_L44
Other DBs
NCBI-GeneID: 412008
NCBI-ProteinID: XP_006559192
BEEBASE: GB43421
AA seq 412 aa
MTEASEDGNYLVRVRAQVMTRDDSSGGWVPLSGGGLANVSVRRRPTSSGGHQSNNTNGSG
ISTTTASTTNTTQSVSTTSITNVQSHGSSNSSPPGAKKRHEYLIYGKRITDQSVVLSCTI
KKDFEYNKVMPTFHHWRTGEKRFGLTFQTAADARAFDKGVRTAVEELLEDAGDEDVFMTL
NLPVEPPESRPSSDTPHGIRVPNYQSQCSDLPDSHKPIHYIGGPSIKVPPSQHPLATTED
VGSDSYSYVQLTTLNHEYLYPIIGDHKGDRLNRHNTSSSLKKPDIIVSQPSKNTMKRNVR
LRCKHCQELYTEQHNPRGSCEYAPDPIRRGIAKISCLSCAQGMLYHCMSDAEGDFAQNPC
SCSTEEGCGRRWFGLALLSLIVPCLWIYPPLRAVHWCGTSCGMCGGRHHPME
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgacagaggcgtcggaggatggtaactatttagtgagggttcgtgcccaggtaatgaca
agggatgatagttcaggtggttgggttcctttaagtggcggtggtttagcaaatgtttcg
gttagacgaagaccaacttcttcaggtggacatcagtctaataataccaatggatctggt
atttctactacgactgcctctactaccaacactacacaatctgtatctactacaagtatc
actaatgtccaaagtcatggatcttctaatagttctccacctggtgcaaaaaaaagacat
gaataccttatttatggaaaacgcatcactgatcaatcagttgttcttagttgtacaatt
aaaaaagattttgaatataataaggtaatgccaacttttcatcactggaggacaggagag
aaaagatttggacttacatttcaaacagctgcagatgcaagagcttttgataaaggtgtt
cgtacagctgttgaagaattactagaagatgctggtgatgaggatgtttttatgacttta
aacttacctgtggaaccaccagaatcacgtccatcatcagatactcctcatggaatacga
gtgcccaattatcaatcccagtgttcagatcttcctgattcccataaacctattcattat
attggtggaccatctataaaagtgccaccatctcagcatcctttggcaacaactgaagat
gttggatcggatagctactcttatgtgcagctcacaacacttaatcatgaatatttatat
cctatcatcggtgatcataaaggagatcgattaaatagacataataccagcagttctttg
aaaaaaccagatattatagtatctcaaccttctaaaaatactatgaaacgtaacgttcga
ttacgatgtaaacattgccaagaattatatacagaacaacacaatcctagaggatcttgt
gaatatgcacctgatcctattagacgaggaatcgcaaaaatttcatgtctgtcctgtgct
cagggtatgttatatcactgtatgagtgatgctgaaggtgattttgcccaaaatccttgc
agttgtagtacagaagaaggatgtggacgcagatggtttggtttggcattattatcactg
atcgttccttgcttatggatttatcctccattaagagctgttcattggtgtggcacgtcc
tgtggcatgtgtggaggacgtcaccatccgatggaataa

DBGET integrated database retrieval system