KEGG   Apis mellifera (honey bee): 412092
Entry
412092            CDS       T01057                                 

Name
(RefSeq) myosin heavy chain, non-muscle isoform X1
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ame04812]
    412092
   04147 Exosome [BR:ame04147]
    412092
Cytoskeleton proteins [BR:ame04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     412092
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   412092
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N Uso1_p115_C IQ AAA_22
Other DBs
NCBI-GeneID: 412092
NCBI-ProteinID: XP_006569827
BEEBASE: GB51734
UniProt: A0A7M7GY82
Position
LG8:12154084..12175342
AA seq 1983 aa
MADVDSRVDHSDPELRFLSVDRNNFNDPATQAEWTQKKLVWVPHETQGFVAAGIKGERGD
EVEVEIAETGKRVLVAKDDIQKMNPPKFDKVEDMAELTCLNEASVLHNLKDRYYSGLIYT
YSGLFCVVVNPYKRLPIYTEKIMERYKGIKRHEVPPHVFAITDTAYRSMLQDREDQSILC
TGESGAGKTENTKKVIQYLAYVAASKPKSNATPSPALIIGSGNISDKFAVINGELEQQLL
QANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLLEKSRAIRQAKDER
TFHIFYQLLAGASPEQKKEFILEDPKHYPFLSNGALPVPGVDDSAEFFSTVKSMHIMGMT
NEDFSSIFRIVSAVMLFGSMQFRQERNSDQATLPDNTVAQKISHLLGLSVTEMTKAFLKP
RIKVGRDFVTKAQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDRTKRQGASFIGILD
MAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWKFIDFGLDLQPTI
DLIDKPMGIMALLDEECWFPKATDKTFVEKLVGAHSVHPKFMKTDFRGVADFAIIHYAGK
VDYSAAKWLMKNMDPLNENVVSLLQNSQDPFVCHIWKDAEIVGMAQQALTDTQFGARTRK
GMFRTVSQLYKEQLAKLMITLRNTNPNFVRCIIPNHEKKAGKIDAPLVLDQLRCNGVLEG
IRICRQGFPNRIPFQEFRQRYELLTPNAIPKGFMDGKKACEKMIQALELDPNLYRVGQSK
IFFRAGVLAHLEEERDYKITDIIVNFQAFCRGFLARRNYQKRLQQLNAIRIIQRNCAAYL
KLRNWQWWRLYTKVKPLLEVTKQEEKLTQKEDELKQVRDKLELQLHSAQEYERKYQQAME
EKTMLAEQLQAEVELCAEAEEMRARLAARKQELEEILHDLETRIEEEEERSAGLAQEKKK
LQLNISDLEEQLEEEEAARQKLQLEKVQCDAKIKKLEEDLALSDDTNQKLLKEKKILEER
ANDLSQTLAEEEEKAKHLSKLKAKHEATIADLEERLLKDHQQRQEVDRSKRKIETEVSDL
KEQLAERKTQVEEFQLQLGKREEELNQIMAKMDEEGAAKAQAQKALRELESQLAELQEDL
EAEKIARGKAEKLKRDLNEELEALKNELLDSLDTTAAQQELRSKREQELATLKKNLEEET
SIHEATLADMRHKHTQELTALNEQMDALKKTKTVLEKAKATLEAENADLATELRSVSASR
QESDRRRKQAEQQLAEINAKLAEVERNRQELVERVTKLQQESESIMQQLEAAELKASAAL
KASATCESQFTELQQQLEEETRQKLALSSKLRALESEKESLHDQLEEEEEAKRALDKQVL
GLNVQLAEAKKRAEEEAEAAAALEEARKRCMKDIEALQRQVEELQAANDKLDKSKKKIQA
EVEDSIIELEAQRAKVLELEKKQKNFDKVLAEEKAVSEQYAEQRDAAEREAREKETRVLS
LTRELDEMNEKVEELERIRRGLQSELDELVNNQGTADKNVHELEKAKRALESQLAEQRSQ
VEELEDELQFTEDAKLRLEVNMQALRAQFERDLQAKEEQAEEKRRGLVKQLRDLEAELED
ERKQKAAAIAQRKKMEADYKDIEQQLEMHNKVKEDALKQLKKLQAQIKDCTRETEEARAA
RDELAASAKETEKKVKSLEADLMQLTEDFASSERARRAAENERDELQEELNNNANKGTLM
LDEKRRLEARIATLEEELEEEQSNAELLMDRARKAQITIEQLTNDLTTERSTTQKLESHK
LLLERQNKELKAKLTELETAQRAKTKATIQQLESKINNLDEQLETEAKERFAQQKINRKL
EKKLKELSLQLEDERRNSDQYKEQAEKVNARMKALKRQLDEAEEEISRHKAMKRKAQREM
DDMLESQEELTREVANLKNKLRRGGPPISLSSTRLKRGSVQTGGSGDDSTTQDESIDGEE
TVN
NT seq 5952 nt   +upstreamnt  +downstreamnt
atggcggacgttgactcgagggtggatcattcggatcccgaattgcgattcctttcagtt
gacaggaataattttaatgatcctgcaactcaagccgaatggacacagaaaaaattagtt
tgggtacctcacgaaactcagggtttcgttgcagccgggataaagggtgaacggggtgat
gaagtcgaagtggagattgccgaaactggaaaacgggtccttgtcgcaaaagatgatatt
cagaaaatgaatccaccaaaatttgataaagttgaagatatggctgaattaacgtgttta
aatgaagcttctgtactgcataacctcaaagacagatactactccggcctcatttacaca
tactcaggactattctgcgtggtggtaaatccatacaagaggctgccaatttacacggaa
aagataatggagaggtataagggtattaagagacacgaagttccaccccatgtttttgcc
attacggacaccgcataccgttctatgcttcaagatcgtgaggaccagtcaattttatgc
accggtgaatccggcgctggtaaaacagaaaacacgaagaaagtaattcaatacttggca
tatgttgctgcctcgaaaccgaaatcgaatgcgacaccaagtccggcattaatcataggt
tccggaaatatttcggataaatttgcggtaattaacggtgaattggaacaacaactttta
caagcaaatccgattttagaagcttttgggaacgcaaaaacagtgaaaaatgacaattca
tcccgatttggtaaatttatacgaataaacttcgatgcttccggttacattgctggtgca
aacatagaaacgtatcttctggaaaagtcaagagcaattcgacaagcaaaggatgaaaga
actttccatatattttatcaacttctagctggtgcctcacctgaacaaaagaaggagttt
atcttggaagatccaaaacactacccattcttgtccaatggcgcattgccagttccagga
gtagacgattcagctgaattcttctcaactgtaaaatctatgcatatcatgggcatgaca
aatgaagacttttcttcaatttttcgtattgtatccgcggtgatgcttttcggttccatg
caattccgtcaagaaagaaactcggaccaagctacgttaccggataatactgttgctcaa
aaaatttctcatttgttaggtttgagcgtgacggaaatgacgaaagcattcttaaaaccg
agaatcaaagtcggtagagattttgtaacaaaagcacaaacaaaagagcaagttgaattt
gcagtagaggcaatttcgaaagcttgctatgaaagaatgttcagatggcttgtgaacagg
atcaatagatcgttggatcgaacgaaaagacaaggagcaagttttatcggtatcttagat
atggccggttttgaaatatttgaattaaacagttttgaacaattgtgtattaattatacg
aatgaaaaattacaacaattattcaatcataccatgttcattttggaacaagaagaatat
caaagagaaggaatcgagtggaagttcattgattttggattagatttgcaaccaactatc
gacttgattgataaaccaatgggtattatggcattgttggatgaagaatgttggtttccc
aaagcaacagataaaacgtttgttgaaaaattagtaggtgctcatagtgtgcatccaaaa
tttatgaaaacagatttcagaggtgttgcagattttgctattatacattatgctggaaag
gttgattattcagcagctaaatggttaatgaagaatatggatcctttgaatgaaaatgtt
gttagcttactacaaaattcacaagatccgttcgtttgtcatatttggaaagatgcggaa
attgtcggaatggctcaacaagcattgacagatacacaatttggtgcaagaacaagaaaa
ggcatgtttagaacagtttctcaattatataaagaacaattggcaaaattaatgattact
ctaagaaatactaatcccaattttgtgagatgtattatacccaatcatgaaaaaaaagct
ggaaagattgatgcaccattggtattagatcaactgagatgtaatggagttttagaagga
attcgaatttgtcgacaaggatttccaaatagaataccgtttcaagaattcaggcaaaga
tatgaacttttaacaccgaatgcaattcctaaagggtttatggatggaaaaaaagcttgc
gagaagatgattcaagctcttgaacttgaccctaatctttaccgcgttggtcaatcaaaa
attttctttcgtgctggagttttggctcatcttgaagaagaacgtgattataaaattact
gatataattgtcaattttcaagcattctgtcgtggtttccttgctcgtagaaattatcag
aaacgtttacaacagttaaatgctattagaattattcagagaaattgtgctgcttattta
aaacttagaaattggcaatggtggcgtttatatactaaagtaaaaccacttttggaggta
acaaaacaagaagaaaaattaactcaaaaagaagatgaattaaaacaagtacgagataaa
ttagaattacaattacattctgcacaagaatatgaacggaaatatcaacaagctatggaa
gaaaaaactatgttagcagaacaattacaggctgaagttgaattatgtgcagaagcagag
gaaatgcgagcaagattagcagccagaaaacaagaactggaagaaattcttcatgattta
gaaacaagaattgaagaagaagaagaaagaagtgctggtttggctcaagaaaaaaagaag
ttacaattaaatataagtgatcttgaagagcaattggaagaagaagaagctgctagacaa
aaattacagctagaaaaagtacaatgtgatgcaaaaattaagaaacttgaagaagatctt
gcactttctgatgatacaaatcaaaaattattaaaagagaaaaaaattcttgaagaaagg
gcaaatgatttatctcagacacttgctgaagaagaagaaaaagcaaaacatttatcaaaa
ttaaaagcaaaacatgaagcaacaattgcagatcttgaagaaaggttgttgaaagatcat
caacaaagacaggaagtggatagatcaaagagaaaaatagaaactgaggtatcagatttg
aaagaacaacttgcagaaaggaagacacaggtagaagaatttcaattgcaacttggcaaa
cgtgaagaagaattaaatcaaataatggcaaaaatggatgaagaaggtgcagctaaagct
caagcgcaaaaggctcttcgtgaattagagtctcaattagctgaacttcaagaagattta
gaagctgagaaaattgctagaggaaaagctgaaaaattaaaacgagatttaaatgaggaa
ttagaagcattgaaaaatgaattattagattctttagatacaactgctgcgcaacaagaa
ttaagaagcaaacgggaacaagaattagcaacattaaaaaagaatttagaagaagaaaca
tcgatacacgaagcaacgttagcagatatgcgtcataaacatacacaagaattaactgct
ttaaatgaacaaatggatgcattgaaaaaaactaaaactgttttagaaaaagcaaaagca
acattagaggcagagaatgctgatttagctacagaacttagatctgttagtgctagcaga
caagaatcagatagaagaagaaagcaagcagaacaacaacttgctgaaataaatgcaaaa
cttgcagaagtggaaagaaatagacaagaattggtagaaagagtaacaaaattacaacaa
gaatctgaaagtattatgcaacaattggaagcagcagaattaaaagcttctgcagcttta
aaagcttcagcaacttgtgaatctcagtttactgaacttcagcaacaacttgaggaggaa
actagacaaaaattagctttaagttcaaaactgagagcattagaaagtgaaaaggaaagt
ttacatgatcaattagaagaagaagaagaagcaaagagagctttagataaacaggttctg
ggcttaaatgttcagctggctgaagcaaagaaaagagctgaagaggaagctgaagccgct
gcagcattagaagaagcaagaaaaagatgtatgaaagatattgaagcacttcaaagacaa
gttgaagaattgcaagctgctaatgataaattagataaatcaaaaaagaagattcaagca
gaagtagaagatagtattattgaacttgaagcgcaaagagcaaaggtgctggaattggaa
aaaaagcaaaagaattttgacaaggtgctggccgaagaaaaagccgtctccgaacaatat
gctgagcaacgtgatgctgccgaacgtgaggctcgagaaaaagaaactcgtgtcttatct
ttaactcgtgaacttgacgaaatgaatgaaaaagttgaagaacttgaacgaattcgtcgt
ggtttacaatcagaacttgatgaacttgtaaataatcaaggaacagcagataaaaatgta
catgaattagaaaaagcaaaacgagctcttgaatcccaattagcggaacaacgttctcaa
gtagaagaattagaagatgaattacagtttacagaagatgcaaaattgcgtctagaagta
aatatgcaagctttaagagctcaattcgaacgagatttacaagctaaagaagaacaggct
gaagagaaacgaagaggattagtaaagcaattacgtgatcttgaagcagaattagaggat
gaaagaaaacaaaaagctgctgctatcgcacaacgtaaaaagatggaagcagattataaa
gatattgaacaacaattggaaatgcacaataaagtgaaagaagatgcattgaaacaatta
aagaaacttcaagcccaaataaaggattgtactagagaaaccgaagaagctagagctgct
agagatgaactggcagcaagtgctaaagaaactgagaaaaaagtaaagagcttagaagca
gatttgatgcaattaactgaagattttgctagcagtgaacgagctagaagagctgctgaa
aacgaaagagatgaattacaagaggaactcaataataatgctaacaagggaacattgatg
ttagatgaaaaacgcagattggaagctagaatagcaacattggaagaagaattggaagaa
gagcaatcaaatgctgaattactaatggatagagctagaaaagctcaaataactattgag
caactaacaaatgatttaacaactgaaagatcaactacacaaaaattggaatcgcacaaa
ttgttattagaaagacaaaacaaggaattgaaagcgaaacttacagaattggaaactgct
caaagagcaaaaaccaaagcaaccattcaacaattggaatcaaagattaacaatcttgat
gagcaattagaaactgaagcaaaagaaagatttgcacaacaaaagattaatagaaaattg
gaaaagaaattgaaagaattgagtttacagttagaagacgaaagaagaaattcagatcaa
tataaagaacaagcagaaaaagtaaatgctagaatgaaagctttaaaaagacagcttgac
gaagctgaagaagaaattagcaggcataaggcaatgaaaaggaaagcgcaaagagaaatg
gatgatatgcttgaatctcaagaagaattaaccagagaagttgcaaatcttaaaaataaa
ttaagacgaggtggacctccaataagccttagttcgacgcgtctgaaacgcggttccgtt
caaaccggtggatccggcgatgattcaacgactcaggacgaaagcatcgatggtgaggaa
actgtcaactga

DBGET integrated database retrieval system