KEGG   Apis mellifera (honey bee): 412108
Entry
412108            CDS       T01057                                 
Name
(RefSeq) casein kinase I isoform X1
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04068  FoxO signaling pathway
ame04310  Wnt signaling pathway
ame04341  Hedgehog signaling pathway - fly
ame04391  Hippo signaling pathway - fly
ame04392  Hippo signaling pathway - multiple species
ame04711  Circadian rhythm - fly
Brite
KEGG Orthology (KO) [BR:ame00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    412108
   04341 Hedgehog signaling pathway - fly
    412108
   04391 Hippo signaling pathway - fly
    412108
   04392 Hippo signaling pathway - multiple species
    412108
   04068 FoxO signaling pathway
    412108
 09150 Organismal Systems
  09159 Environmental adaptation
   04711 Circadian rhythm - fly
    412108
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ame01001]
    412108
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ame03036]
    412108
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     412108
Protein kinases [BR:ame01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   412108
Chromosome and associated proteins [BR:ame03036]
 Eukaryotic type
  Centrosome formation proteins
   Kinases and associated factors
    412108
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH AOX Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 412108
NCBI-ProteinID: XP_006559017
BEEBASE: GB55165
UniProt: A0A7M7IIX3 A0A8B7KPB4
Position
LG11:complement(2382794..2411786)
AA seq 468 aa
MELRVGNKYRLGRKIGSGSFGDIYLGTNISTGEEVAIKLECIKTRHPQLHIESKFYRMMQ
GGVGIPTIKWCGSEGDYNVMVMELLGPSLEDLFNYCSRTFSLKTVLLLADQLISRTDYIH
SRNFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKYRDGRTHKHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNRGSLPWQGLKAATKRQKYERISEKKMSTPIEEL
CKGYPVEFVQYLRYCRGLRFEERPDYSYLRQLFRTLFHEEGFTYDYVFDWNRLKFGNVRQ
QTLSSTQQTPMQSQHTNAALPSGTNNDQEHRSRPYTRQCLANISVGTVGPTVGGTTTNLR
SMRQKREAIDALRDQDNQESDLQASGTGGQERRVSMRLHRRDAAAGEMQPKTKLNLHRRQ
DDGSRPAKLTQLRNQPERTAKAKSQQLHDPITFEPNLRKPTRSQNPLR
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggagctacgcgttggaaataagtaccggctcggacggaaaatcgggagtggctccttt
ggcgacatttatctaggtaccaatatctctaccggcgaggaagtcgccatcaagctagaa
tgtataaaaacgcggcatccgcagttacacatagaatcgaagttctacaggatgatgcaa
ggtggtgttggaataccaactataaaatggtgtggttcagaaggtgactacaatgtaatg
gtaatggagctactaggtccatcattggaggatctatttaattactgttcaagaactttt
tctttgaaaacagtcttgcttctcgccgatcaattgataagtagaacggattatattcac
agtcgcaattttatccatcgagacatcaaaccagataattttttgatgggcttgggaaaa
aagggaaatctcgtatatattatagattttggattggccaaaaagtatcgcgatggccgt
actcacaaacacataccttatcgagaaaacaagaacttaacaggaacagccagatacgcg
agtattaatacacatttgggaattgaacaatcacgacgagacgaccttgaatccttggga
tatgtccttatgtatttcaatagaggtagcttaccctggcaaggtctgaaagcggcaact
aaacgacagaaatacgagcgtatttctgaaaagaaaatgtctacacccatcgaagaatta
tgcaagggttatcctgttgagttcgtgcaatatctaaggtattgtcgaggactacgattc
gaggaaaggccggattattcgtatcttcggcaacttttccggacgttgttccacgaagaa
ggcttcacatacgattacgtcttcgattggaataggctgaaattcggtaacgtgaggcaa
caaacattgtcttcgacgcagcaaacaccgatgcagtcgcaacatacgaacgcagcgctg
ccctctgggactaataatgatcaagagcatcgatctagaccttacacccggcagtgtttg
gcaaacatatcagtggggacggtgggtccgactgtaggtggaacgactacaaatttgaga
agcatgcggcaaaaacgcgaggcgatagacgctcttcgcgatcaggacaatcaggagagc
gatcttcaagcgtcgggcacaggtggccaagaacgaagagtcagcatgaggttgcaccgt
agggatgcagctgctggagagatgcaaccgaagaccaaactaaatctacatcgacggcag
gacgatggttctcggccggcgaaactcacgcaattacgcaatcaaccggaaagaactgcg
aaagcgaagtcgcaacagttgcacgatccgattactttcgagccaaacttgaggaaaccc
acgaggagtcaaaatccattgcgctag

DBGET integrated database retrieval system