KEGG   Apis mellifera (honey bee): 412209
Entry
412209            CDS       T01057                                 
Name
(RefSeq) probable cytochrome P450 6a17
  KO
K14999  cytochrome P450 family 6 [EC:1.14.-.-]
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ame00199]
    412209
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     412209
Cytochrome P450 [BR:ame00199]
 Cytochrome P450, animal type
  CYP6 family
   412209
SSDB
Motif
Pfam: p450 DHOase HypD
Other DBs
NCBI-GeneID: 412209
NCBI-ProteinID: XP_395671
BEEBASE: GB49885
UniProt: A0A7M7R9P2 A0A8B9B1W4
Position
LG13:10723047..10725867
AA seq 501 aa
MLHHFHILTAFVAIFLALYYYLTSKFDFWKNRGVSGPRPVPFFGNAKDVLLRKIGIGSFI
AELYKRYDNEAMFGIFIGRSPNLVLRDLDLIKDVLIKDFSIFDNRGLNIPERAEPFSVNL
FSVDATRWRPLRMRLSPVFTSGKLKEMFPLILECAEHLEQCLEDAVKRGGPVDCFEIPAR
YTTDVIGSCAFGINMNALSDERSEFRKMGRNMFDQNMIKFTRNLLRDFFPRFYNLLGFVL
PYTESTVFMTKLIKGTIKYREENDVVRPDFVNLLMELKKHPEKLKNIEITDTLLAAQASV
FFAAGFETSSTTMAHALYEMALNPDIQDKLRNEMKEFHAKNNGNLKYEDIKEMKYLDKVF
RETLRKYPPGMLLRRKCNSNYTFHGTKVSIPAGTSVIIPLYAIQIDPKFYENPDVFDPER
FNEDAVAARHPMTYLPFGDGPRNCVGARFAVYQTKVGLIKILQNFRVDVCEKTMIPYVKK
INSITLAPRDGIFLKIEKITD
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgctccatcattttcatatattaaccgcatttgtcgcgatttttctcgctttatattat
tacctcacgtcgaagtttgatttttggaaaaatcgtggcgtgagtggacccaggcctgta
ccattctttggaaacgccaaagatgttctgctacgaaaaattggaattggcagcttcatc
gcggaactctataagagatacgacaacgaggcaatgttcgggatattcatcggcagatca
cctaatctcgttttgcgcgatcttgaccttatcaaggatgttttaattaaagatttctct
atatttgataatcgaggattaaatattcccgaacgagccgaacctttttccgtaaatttg
ttcagcgtagacgctacaagatggcgaccattaagaatgagattgtcaccggtatttacc
tctggtaaactgaaggaaatgttccccctgatattggaatgcgccgaacacttggagcaa
tgtttggaggatgctgtgaaaagaggtggtcctgtcgattgctttgaaataccagctaga
tacacgacagatgttatagggagttgcgctttcggaatcaacatgaacgcgttgtcggac
gagcgtagtgaattccgcaaaatggggcgaaacatgttcgatcaaaatatgatcaagttt
acgaggaatttacttcgagatttctttccacgtttctacaatttgcttggcttcgtatta
ccgtacacggaatcaaccgtgttcatgaccaagctaatcaagggaacgatcaaatacagg
gaagagaacgacgtcgtgaggccagattttgtaaatttgttgatggaattgaagaagcat
ccggaaaaattaaagaatattgaaataacggatactttacttgccgctcaagcttccgtt
ttcttcgcggctggatttgaaacgtcatcgacgacaatggcacacgctctttacgaaatg
gcactgaatcctgacatacaagataaattacgaaacgaaatgaaagaattccacgcgaag
aataatgggaatctgaaatacgaggatatcaaagaaatgaaatatttggacaaagtattt
agagaaacacttagaaagtatccaccaggaatgcttctgaggcgaaaatgcaactctaat
tataccttccatggtacaaaagtatcgatacccgctggtacttctgtaattattcctctg
tatgcaattcaaatagatccaaaattttatgaaaatccagacgtgttcgatcctgaaaga
tttaacgaggatgcagtagctgcaaggcatccaatgacctatttaccatttggtgatgga
ccaaggaattgcgttggagcacgatttgccgtttatcaaacaaaagttggattgataaaa
atactgcaaaattttagagtagacgtttgcgaaaagacgatgattccttatgtaaagaag
ataaattcaattacattggcacctagagatggaattttcttgaagatagaaaaaataact
gattaa

DBGET integrated database retrieval system