KEGG   Apis mellifera (honey bee): 412263
Entry
412263            CDS       T01057                                 
Name
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X1
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ame01002]
    412263
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ame04147]
    412263
   04090 CD molecules [BR:ame04090]
    412263
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     412263
Peptidases and inhibitors [BR:ame01002]
 Metallo peptidases
  Family M1
   412263
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   412263
CD molecules [BR:ame04090]
 Proteins
  412263
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 412263
NCBI-ProteinID: XP_006571773
BEEBASE: GB42326
UniProt: A0A7M7LQ36
Position
LG1:complement(27551458..27564651)
AA seq 1002 aa
MPGGTSTRESSEAIRMEPLGRTSSSRSPGQNGTANTTTEVPINSGDSNTGLHKRSIYEHN
GIVCSQKRALCIATVVFAILFAISLIIAFAGPQNDCPCAGEKPAIVDIEDDEKSSEPLAT
NGEVFPWNNVRLPTFAHPTRYNITIHPNLTTLEVKGQVTIEFYVDRETNYIVFHSKNLTI
NEKMIQDRKGHRLKISRLLEYPKHQQLYLELEESKFRKRGNYTVHLRFISKLSSELEGFY
LSSYVTPEGEKRYLATTHFEPTYARSAFPCFDEPQFKAKFKVSIFRDRFHIALCNMPVMN
TEDAGFYMGTGLLRDDFQESVEMSTYLVAFVVCDFKRVSELTKRNISVSVYASEAMLPQA
RYAVTTAARIMDYFESFFGVHYPLPKQDLIAIPDFGTGAMENWGLITYRETSILYDPEES
STNIHEWIGTIVAHELAHQWFGNLVTMKWWNDLWLNEGAASFFEYKGVNHISPEWSMMDK
FILEKTQSALDLDALASSHPISVQVKDPNEIEAIFDNISYNKGASILNMLEGFLCEDVLK
SGLNDYLNSHAYGNADTNDLWAAFTKHANNTFDVKAIMDTWTQQMGFPLITITRNGNTIT
AAQKRFLISPRENDTESQRARSSFDYKWYIPLSYYTDKEPRKLHNVWMNLTDVTFEIPSD
VKYIKCNVNQSGFYRVTYPEEMWTSIIATLLNDHTKFSPADRANLIDDAFTLCEAGELNA
TVPLRLSLYLLNERDYAPWTTALRYLHSWKERLSESPGYKRYISFFKKLLIPVTKYVGWS
DEGSHLKKLLRIAVLQSAVSIKLEDVVKPAKSLFDDWMLKGKRIAPNIRNVVYIAGIKFG
GEKEWNHCWENYQETQVSSEKLIMLEALGASTDSWLLQRYLLRSLDRDMVKSQDMETVII
SVASNSDGQFLVWRHLKAYWPQIHVLLGNGSLSGLISVVVSNFFTEYDYHEVSEFFKKVD
VGSGQRALEQSLETIKFNIHWVKENADIVDRWLVNHSNVETS
NT seq 3009 nt   +upstreamnt  +downstreamnt
atgccagggggaacttcgacgcgagaaagcagcgaggcgatccggatggagcctttgggt
agaacctcgagttcgcggagtcccggccaaaacgggactgccaacaccaccaccgaggtc
ccgataaattcaggagacagtaacacgggattgcacaaacgtagtatttacgagcataat
ggaattgtgtgttcacaaaaaagggctctctgcatagccaccgttgtttttgcgatcctt
ttcgccatatcactcatcattgccttcgcgggaccacaaaacgactgcccttgcgctgga
gagaagccagccatcgtggatatcgaggacgatgaaaaaagcagcgagcctcttgcgact
aatggagaggtgttcccttggaataacgtgagattacctacgtttgcgcatcctaccagg
tacaatatcaccatccatccaaatcttacaacgttagaggtaaaaggacaggtcacgatc
gagttctacgtcgatagagagaccaactatatcgtcttccatagtaaaaatttgacaata
aacgagaaaatgatccaagaccgcaaagggcacagattaaaaatttcgagattgctggaa
tatccgaaacaccaacaattatatttagagctggaagagagcaaatttcgaaagagagga
aattacacggtacacttgaggttcatctcgaaacttagcagcgaactggagggattttat
cttagcagctacgttaccccggaaggagaaaagaggtacctcgcgacaacccatttcgaa
cctacgtacgcacgctcggcatttccatgcttcgacgaaccgcaattcaaagctaagttc
aaggtttcgatattcagagacagatttcacatcgcgttgtgcaacatgcctgtaatgaac
accgaggacgcgggattttacatgggcacgggactcctccgcgacgacttccaagaatcc
gtagagatgtccacgtatttggtggcgttcgtcgtgtgcgatttcaaacgagtctcggaa
ctaacgaaaagaaatatttccgtgagcgtttacgcgtcagaggcgatgctcccgcaggcg
agatacgcggtgacaacagccgctcgtataatggattacttcgagtcttttttcggggta
cattatccgttgcccaagcaagatctgatagccatccccgatttcggcaccggggcgatg
gaaaactggggcctgatcacgtatcgggagacgtcgatactttacgatccggaagagtcg
tcgaccaacattcacgagtggatcgggacgatcgtggctcacgaactggcccatcaatgg
ttcggcaatctggtcaccatgaaatggtggaacgacttgtggttgaacgagggggcggcc
agtttcttcgagtacaagggggtgaatcacatttcacccgagtggagcatgatggacaag
tttatattggagaaaacgcaatcggcgctcgacctcgacgcgttggccagcagtcatcct
ataagcgtccaggtcaaagatccgaacgagatcgaggcgatattcgacaatatcagttac
aataagggtgcttccattctcaacatgctcgaaggctttttatgcgaggacgttctcaaa
agcgggttgaacgattatctgaattcgcacgcgtatggaaatgcagacaccaacgatctt
tgggcggcctttaccaaacatgccaataacacttttgacgtgaaagctatcatggacacg
tggacgcagcaaatgggtttccctctgatcacgattacgcgcaacgggaatacgatcaca
gctgctcagaagagatttctaatttcgccgagggaaaacgacacggaatcgcaacgagcg
agatcgtcgttcgactacaaatggtacatcccattgagctactacacggacaaggaaccg
cgcaaacttcacaacgtgtggatgaatttaaccgacgtgacgttcgagatacctagcgac
gtgaaatacataaaatgtaacgtgaatcaaagcgggttttatcgcgtaacttatccggaa
gagatgtggacgtcgatcatcgctaccttgttgaacgatcacaccaagttcagcccagcg
gaccgtgctaatcttatcgacgatgcgttcacgttgtgcgaggcgggcgagttgaacgcc
accgtccctcttcgattgtccctttaccttttgaacgaaagggattacgctccgtggaca
acggcgctcagatatctacattcttggaaagagagattgagcgagagtcctggatacaaa
agatatatctcgttctttaagaaactcttgattccggtcacgaaatacgtgggttggtcc
gacgaggggtctcatttgaagaaattattgaggatcgccgtacttcaatcggctgtgtct
ataaaattggaagacgtggtaaaaccagccaaatcccttttcgatgattggatgttgaaa
ggtaaacggatcgcgcccaatatacggaacgtggtgtacattgcaggaatcaagtttggc
ggtgaaaaggagtggaatcattgctgggaaaattatcaagagactcaagtatcgagcgag
aaactgataatgttggaagcgttgggagcgagcacagattcttggttgctgcaacgttat
cttttacgatcgttggaccgtgacatggtgaaatcgcaagacatggaaaccgttataatt
tccgtcgcctccaattccgacggtcaatttctcgtgtggcgtcaccttaaagcgtattgg
cctcagatacacgttttacttggcaatggatcgttgagcggacttatatctgtcgtggtt
tccaactttttcacggaatacgactaccacgaggtttcggaattctttaaaaaggtggat
gtcgggagcggtcaacgagcattggaacaaagcctggaaacgatcaagttcaatattcat
tgggtaaaagagaatgcggatatcgtcgatcgatggctggtgaatcattcgaacgttgag
acgagttaa

DBGET integrated database retrieval system