KEGG   Apis mellifera (honey bee): 412355Help
Entry
412355            CDS       T01057                                 

Definition
(RefSeq) diacylglycerol kinase eta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00561  Glycerolipid metabolism
ame00564  Glycerophospholipid metabolism
ame01100  Metabolic pathways
ame04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    412355
   00564 Glycerophospholipid metabolism
    412355
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    412355
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     412355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAGK_cat C1_1 SAM_2 SAM_1 C1_2 RTP1_C1 PH PSI
Motif
Other DBs
NCBI-GeneID: 412355
NCBI-ProteinID: XP_016772995
BEEBASE: GB52661
Position
Un
AA seq 1509 aa AA seqDB search
MSPKQQRTHSRFKVITPFRSLVLCGESRQEMEDWLNALRTVTKNCAQTDSGIAEMLSGNH
QWYATSHARPTYCNVCRDALYGVTSHGLSCEICKYKVHKRCSIKAINNCKWTTLASIGKD
IIEDKDGNITMPHQWMEGNLPVSSKCSVCDKTCGSVLRLQDWRCLWCRATVHTACRPAMS
IKCPLGPVKLSVVPPTALHSIGSDEAWEAIRPTGCSPLLVFVNSKSGDNQGIKFLRRFKQ
LLNPAQVFDLIKGGPGPGLRLFRHFDPFRILVCSGDGSVGWVLSEIDRLGMHKQCQVGVL
PLGTGNDLARVLGWGSSCDDDAHLPQLLEKYEKAGTKMLDRWSIMTFERSISLPCPKNVL
NHPDTVQKSNIASQYEENILTHITNVLESDQENVILSSIRILCDTVKDFVAYIMENMNSE
DQQVEEKCKILQQKLNLFLTILCKEEEYLSTEHINDVDNINLNTEISVSPDNCEKGVLEK
PEKDITNLKKVQKRKQFADKEIVMSRANSLKRTVRKFVEYAQLVIDDQININSKHGIKIA
NTNSSLDDSTIINSILSKKKQLNIPGLKVDHVESLSVETLIESVKSTDNSICTSPTPNVA
SLSPIPDLRRDSQPEEILTLPAPDGFADSRRNSENLPQGSFNFHTSMIPCMDNEQETEIL
ESNDQQISDSNNIEISSEFQVSVTRTTFDTSSPSEDGTTQDISSDIDSIQSPEHEQKSEN
KAKMEVLKGYIGSDTFDSEIRHIDSPDNSEMITSDTFDSEIRHIDSPDNSEMITSELQNS
ESLIGQDLTSIINGEEYDSVREYLENELENTDITNEIAKRSFKKSTKYSTVIEMENKFKY
KIGSTEQNVNKANKFKEQDGKASDLLRPVCCFTVSSDTTPTNEKRNSFPPTISVIINPPS
PSMSIESQHDLDAEYKMNPYLRRHTDESMERLSVELPELGFSPQATRRISSGSLLKASEV
VSLAATAARFGGSNASLRHERVKSVDKTEDVKKLPIINPLVQLPMWPNVSGGTGLISQAL
LANADALCAAVSPLMDPDETLMEGYFERCVMNNYFGIGIDAKISLDFHHKREEHPEKCRS
RAKNYMWYGVLGSKQWLQKTYKNLEQRVQLECDGQRIPLPSLQGIVVLNIPSFMGGTNFW
GGTKEGDLFLAPSFDDRILEVVAVFGSVQMAASRLINLQHHRIAQCQTVQINILGDEGVP
IQVDGEAWIQPPGIIRIIHKNRMQMLYRNRALETSLKTWEEKQRSTLNAISQSISTLSTT
QLQSQSKLLQVHNKPTHLNEEEMYILLGFIEVVTTLVKWVKLLIISHPSLEPDLYQVAAR
TAQALEQVHPDGKILQGINLRPVVTELVSSARQLYEDSCELLRDKAHNLKLREDLENKLS
FSLASMEQELKKCTFDEGGTRLVYLQNLPSDEQGDKKNRHRGLFWLKFRRSGINSGTNLA
RDQVTTWGVQEVCCWLENLQLGEYTEKFISHDIRGRELLSLARRDLKELGIIKVGHVKRI
LQAINDLNN
NT seq 4530 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccaaagcaacaaagaacccattctcgattcaaggtgataactccatttcgatca
ttagttctttgtggtgaaagtagacaagaaatggaagattggttgaatgcattaagaaca
gtaacaaagaattgcgctcagacagattctggaattgcagaaatgcttagtggtaatcat
caatggtatgcaacaagtcatgcgagaccaacatattgtaatgtttgtagagatgctctt
tatggtgttacttctcatggtttaagttgtgaaatatgtaaatataaagttcataaacga
tgtagtataaaagcaataaataattgcaaatggaccactttggcatctattggcaaagac
attattgaggataaagatgggaatattactatgcctcatcaatggatggaaggcaattta
ccggtatcctcaaaatgttctgtatgtgataaaacttgtggttctgtactcaggcttcaa
gattggagatgtttatggtgtagagctacagtacatacagcttgtagacctgccatgagt
attaaatgtccattaggaccagttaaattgagtgtagttcctcctacagcactgcatagt
ataggtagtgatgaagcttgggaagctataagacctactggatgcagtccacttttagta
tttgtaaatagtaaatctggtgacaatcaaggtattaaatttcttagaagatttaaacaa
ttattaaatccagcacaagtatttgatcttataaaaggaggaccaggaccagggttaaga
ctatttcgtcattttgatccatttcgtattttggtatgcagtggggatggatctgttggt
tgggttctttctgaaattgatcgtctaggaatgcataagcagtgtcaagttggagttcta
ccattgggaacaggaaatgatttggcacgtgttttgggttggggatcttcttgtgatgat
gatgctcatttacctcagttattagaaaaatatgaaaaagcaggcacaaaaatgcttgat
cgatggagtattatgacttttgaacgtagtatttctttgccatgtcccaaaaatgtttta
aatcatcctgatactgtacaaaaatcaaatattgctagtcaatatgaagagaatattctt
acccatataacaaatgttttggaatcagatcaagaaaatgtaattttatctagtattaga
attttatgtgatacagtaaaagattttgtagcatatataatggaaaatatgaactcagag
gaccaacaagtggaagaaaaatgtaaaatacttcagcaaaaacttaatttgttcttaaca
atattatgcaaagaagaagaatatctatcaactgaacatataaatgatgttgataatatt
aatttaaatactgaaatttctgtttcacctgataattgtgaaaaaggagtattagaaaag
ccagagaaagatataacaaatttaaaaaaagtgcaaaaaagaaaacaatttgcagataaa
gaaattgtcatgtcaagagcaaacagtttaaaaagaactgtaagaaaatttgtagaatat
gctcaattggttatagatgatcaaattaatatcaactcaaaacatggtattaaaatagca
aatacaaatagttcattagatgatagtacaataataaattcaatattgagcaaaaaaaaa
caattaaatattcctggtttaaaagtagatcatgttgaaagtttatctgtagaaacacta
atagaatctgtaaaaagtacagataattcaatatgtactagtccaactcctaatgtagca
tctttaagtcctataccagatcttagaagagattctcaacctgaagagatattaacatta
cctgctcctgatggttttgctgatagtagacgaaatagtgaaaatttaccacaaggttcg
tttaactttcatacctctatgattccttgtatggataatgaacaagaaacggaaatactt
gaatctaatgaccaacaaatatctgattccaataatatagaaatttcttcagaatttcaa
gttagtgttacaagaaccacttttgatacaagttcaccttcagaagatggaactacacaa
gacatttcatctgatatagattcaatccaatcaccagaacatgaacaaaaatcagaaaat
aaagctaaaatggaagtacttaaaggatatataggtagtgatacatttgattccgaaatt
agacatattgattctcctgataattcagaaatgatcactagtgatacatttgattccgaa
attagacatattgattctcctgataattcagaaatgatcactagtgaattacaaaattct
gaaagcttaataggacaagatttaactagtattataaatggagaagaatatgattctgta
agagagtatttagaaaatgaattagaaaatactgatattacaaatgaaattgctaaacgc
tcatttaagaaatcaacaaaatattctactgttatagaaatggagaataaatttaaatac
aaaattggatcaacagaacaaaatgtaaacaaggcaaataaatttaaagagcaagatggt
aaggcatctgatttattgcgccctgtatgttgctttactgtatcttcggatactactcca
acaaatgaaaaacgtaatagctttccacccacaataagtgttataatcaatcctcccagt
ccatcaatgtcaattgaaagtcaacatgatttagatgcagaatataaaatgaatccttat
ttaagacgacatactgacgaaagtatggaaagattaagtgtggaactacctgaattgggt
ttttctcctcaagcaactcgtcgaattagtagtggaagtttgttaaaagcatcagaagtt
gtttctttagctgctacagctgcaagatttggtggttctaatgcaagcttacgtcatgaa
agagtaaaatctgttgataaaacagaagatgttaaaaaacttccaattatcaatccatta
gttcagttacctatgtggccaaatgttagtggaggaactggacttattagtcaagcatta
cttgcaaatgcagatgcactttgtgctgcagtatcaccattaatggatcctgatgaaaca
ttaatggaaggttattttgaacgttgtgttatgaataattattttggaatcggcatagat
gcaaaaattagtcttgatttccatcataaaagagaagaacatcctgaaaaatgtcgatca
cgagcaaagaattatatgtggtatggtgtattaggatccaaacaatggttgcaaaaaaca
tataaaaatcttgaacaaagagtacaattagaatgtgatggccaacgaataccattacct
tccttacaaggaattgttgtattgaacattccaagctttatgggtggtacaaatttttgg
ggaggcacaaaagaaggagatttatttttagcaccttcatttgatgatcgtatattagaa
gttgtagctgtatttggttctgttcaaatggctgcatcacgattaattaatttacaacat
catagaattgcacaatgtcaaacagttcaaattaatattttgggtgatgaaggagtacct
atacaagttgatggcgaagcttggattcaacctcctggtattatacgtattatacacaaa
aatcgtatgcaaatgctttatagaaatagggcacttgaaacatctttaaaaacatgggaa
gaaaaacaacgcagcacactcaatgcaatatcccaatcaatatcaactttaagcactaca
caattgcaatcacaatctaaacttcttcaagtacataataaaccaacacatttaaatgaa
gaagaaatgtatattctattgggatttattgaagtggttacaactttagttaaatgggtt
aaacttctcattatatcacatccaagtttggaaccagatttatatcaagttgcagcacga
acagcacaagcacttgaacaagttcatccagatggaaaaattttgcaaggaattaattta
agaccagtagtaacagaattggtgtcaagtgcaagacaactttatgaagactcgtgtgaa
ttactcagagataaggcacataatttaaaattacgagaagacttagaaaataaactttca
ttttctttggccagtatggaacaagaattaaaaaaatgtacatttgatgaaggaggtaca
agattagtatatttacaaaacttaccatcagatgaacagggagataaaaagaatcgtcat
agaggtttgttttggttaaagtttcgacgttcaggaattaattctggaacaaatctcgct
cgagatcaagttactacatggggcgtacaagaagtatgttgctggttggaaaatctacag
ttgggtgaatataccgaaaaatttatttctcacgatataagaggtagggagttattatca
ctagctcgtagagatctcaaagaacttggtattattaaagtaggacatgttaaacgaatc
ttacaagctatcaatgatctaaataattaa

DBGET integrated database retrieval system