KEGG   Apis mellifera (honey bee): 412388
Entry
412388            CDS       T01057                                 
Name
(RefSeq) CCR4-NOT transcription complex subunit 9
  KO
K12606  CCR4-NOT transcription complex subunit 9
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    412388
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ame03019]
    412388
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     412388
SSDB
Motif
Pfam: Rcd1
Other DBs
NCBI-GeneID: 412388
NCBI-ProteinID: XP_006572212
BEEBASE: GB50867
UniProt: A0A7M7H6E7
Position
LG16:876726..879002
AA seq 310 aa
MTRMSSQQSPAALQSTVDREKVYTWIIELSNSETRENALLELSKKREVVPDLAPMLWHSF
GTIASLLQEIINIYPAINPATLTAYQSNRVCNALALLQCVASHPETRSSFLQAHVPLFLY
PFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVITFLLTTEIIPLCLRIMESGSELSKT
VATFILQKILLDDSGLSYICQTYDRFSHVAMILGKMVLSLAKDPSARLLKHVVRCYLRLS
DNPRALLALRQCLPDQLRDNTFATCLQEDASTKHWLNQLLKNLETGPQPGPPAQPGQQDP
RTIGMSPLAS
NT seq 933 nt   +upstreamnt  +downstreamnt
atgacgagaatgagttcgcagcaaagtccagccgcgttacaatcgacggtggatcgtgaa
aaagtttatacttggataattgaattatctaattcagaaacgagagaaaatgcattatta
gaacttagtaaaaaacgagaagtagtaccggatttagctccaatgctgtggcattcattt
ggaactatagcgtcgctacttcaagagataataaatatttatcctgctattaatccagct
acattgactgcatatcagagtaatcgagtatgtaatgcattagctttattgcaatgcgtt
gccagtcatccagaaactagatcatcatttcttcaagcccatgtaccattgtttttatat
ccatttttgcatacagtcagcaagacacgtccatttgaatatcttcggttaacgagtttg
ggagtaataggagctttggtaaaaacagatgagcaagaggtgatcacatttttactcact
acggaaattattccactttgtttacgcatcatggagagtggttcagagctgagcaagaca
gtagctacgtttattctacaaaagattctactcgatgatagtggtctttcatatatatgc
caaacgtatgatcgattcagtcatgttgcaatgattttaggaaaaatggtattgtccttg
gccaaagatccttcagccagattgttgaaacatgtagttagatgttatctcagactatca
gataatccaagagcattattagcgcttagacaatgtttgccagatcaacttagagataat
acatttgcgacatgtttgcaagaggatgcatctactaaacattggttaaatcaacttttg
aagaatttagaaactggtccacaaccaggacctccagcacaaccaggtcaacaagatcct
aggactattggcatgtcacctcttgcttcttaa

DBGET integrated database retrieval system