KEGG   Apis mellifera (honey bee): 412573
Entry
412573            CDS       T01057                                 
Name
(RefSeq) cGMP-dependent 3',5'-cyclic phosphodiesterase
  KO
K18283  cGMP-dependent 3',5'-cyclic phosphodiesterase [EC:3.1.4.17]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00230  Purine metabolism
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    412573
Enzymes [BR:ame01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     412573
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3
Other DBs
NCBI-GeneID: 412573
NCBI-ProteinID: XP_396028
BEEBASE: GB45314
Position
LG6:15636901..15641585
AA seq 731 aa
MKMSLINLNTSQMEQILSLLEDMYYLSYPQSQQKLNKYIQTATNTKLCFLIPILAKSEEM
IIHVIGEKILDRELRFSISNNILHKTIQNKKPTAIDMTMLDEELLYYLEPICSISNSFLT
IPIVHPKQNYIALLVCLIDNDSTNEIICKCAIVQDCFRFCLGFLLNSLTCYEETRLKLQS
QKLLDVSRKLYIYFGEISDLLREIMTEAKNLTNAERCSLFLLDPEQQDLVAKVFDGIAVD
KSLEEMRIPIGQGIAGHVATSGKVLNIRNAYEHPLFYPGIDKITGFKTRNILCFPIRDEE
KIVGVAQLCNKKNGLYFDVFDEEVATAFSVYCGISLMHSIIYKKMQIAQARSKLSNEVMM
YHMKIDEESIEVILNCKDKHDIKDFNKFEFCPRNVPYDCTPCYIIKMFNDLGLIKYWKLK
LPTLIRFILYVRKGYRDAPYHNWIHAFSVTHFAYLLIENLNLINENYLTHLEALIFLVSC
LCHDIDHRGTNNMFQMISSTVLATLYSSEGSVMERHHFAQTMCILNTEGCNIFENCNSEH
YAEILNMLKNNILATDLASHFRKIEKQEMMIKDKFDKNNLTHKKLLIDMFMTCCDLSDQT
KYWEITKKTAEKIYEEFFSQGDLEKSMGTSPTEMMDRERASIPDLQVHFITNVVLPLFIN
LSTLFPMIQPLIDVLKENRDLWEESKNIFKKYMEKGMTSIAILLNPTFEKEVAELYAQRK
KDFSFNDSTLK
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgaaaatgagtttaattaatttaaacacatcacaaatggaacaaattctttcacttcta
gaagatatgtattatctttcctatcctcaatcacaacaaaaattaaataaatatatccaa
actgcaacaaatacaaaattatgttttcttataccaattttagcaaaatcagaagaaatg
ataattcatgtaataggagaaaaaattttagatagagaattaagattttctatatcaaat
aatattttacataaaactatacaaaataaaaagccaactgctatagatatgacaatgctt
gatgaagaattattatattatcttgaaccaatatgttcaatatcaaattcatttttaact
attcctatagtgcatcctaaacagaattatatagctttgttagtttgtttgattgataat
gattctacaaatgaaattatatgtaaatgtgcaatagtacaagattgttttagattttgc
ttaggatttcttctaaattcactcacatgttatgaggaaactcgattgaaattacaaagt
caaaagttacttgatgtttctagaaaactttatatatatttcggagagatttctgattta
ttgagagaaataatgacagaagctaaaaatctaacaaatgcagaacgctgttcattattt
ttattagatcctgaacaacaagatctagttgctaaagtatttgatggtattgctgtggat
aaatctttggaagaaatgagaataccaataggacaaggtatagcaggtcatgttgcaact
agtggaaaagtgcttaatattagaaatgcatatgaacatcctcttttttatcctggtata
gataaaataacaggatttaaaacaagaaatattttatgttttccaattagagatgaagaa
aaaattgtaggtgttgcacaactttgtaacaaaaagaatggattatactttgatgttttt
gatgaagaagttgcaacagcatttagtgtttattgcggcatttctttaatgcatagtatt
atttataaaaaaatgcaaattgctcaagcaagaagtaaacttagtaatgaagtgatgatg
taccatatgaagatagatgaagaaagtattgaagtaattttgaactgtaaggataaacat
gatataaaagattttaataaatttgaattttgtcctagaaatgtaccttatgattgtaca
ccttgttatataattaaaatgtttaatgacttaggtcttattaaatattggaaattgaaa
ttgccaactttaatcagatttatattgtatgtaagaaaaggatatagagatgcaccatat
cataattggatacatgctttttcagtgacacattttgcatatttattaatagaaaattta
aatcttattaatgaaaattatttaacacatttagaagctttaatttttctagtatcttgt
ttatgtcatgatatagatcatagaggaacaaataatatgtttcaaatgataagctctaca
gttttagctactctatatagttctgaaggttctgtaatggagagacatcattttgcacaa
accatgtgtattttaaatacagaaggttgcaatatatttgagaattgtaacagtgaacat
tatgctgaaatattaaatatgttgaagaataatatacttgcaacagatttagcatctcat
tttcgaaaaatagaaaaacaagaaatgatgattaaagataaatttgataaaaataatctt
acacataaaaaattattgatcgacatgtttatgacatgttgtgatcttagtgatcaaact
aaatattgggaaattactaaaaaaactgcagaaaaaatttatgaagaatttttttcacaa
ggagatttggaaaaaagtatgggtacttctcctacagaaatgatggatagagaacgagca
tctataccagatcttcaagttcattttattacaaatgtagttcttccacttttcattaat
ctttctacattatttccaatgatacaaccacttattgatgtactgaaagaaaatcgagat
ttatgggaagaatctaaaaatatatttaaaaaatatatggaaaaaggaatgacaagtata
gctatcctattgaatcctacttttgaaaaagaagtagcagaactttatgctcaacgcaaa
aaagatttcagttttaatgattcaacattaaaataa

DBGET integrated database retrieval system