KEGG   Apis mellifera (honey bee): 412808
Entry
412808            CDS       T01057                                 
Name
(RefSeq) aminopeptidase Ey isoform X1
  KO
K11140  aminopeptidase N [EC:3.4.11.2]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00480  Glutathione metabolism
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    412808
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ame01002]
    412808
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ame04131]
    412808
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ame04147]
    412808
   04090 CD molecules [BR:ame04090]
    412808
Enzymes [BR:ame01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     412808
Peptidases and inhibitors [BR:ame01002]
 Metallo peptidases
  Family M1
   412808
Membrane trafficking [BR:ame04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    412808
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   412808
CD molecules [BR:ame04090]
 Proteins
  412808
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1 Peptidase_M1_N Pih1_fungal_CS
Other DBs
NCBI-GeneID: 412808
NCBI-ProteinID: XP_006565537
BEEBASE: GB42484
UniProt: A0A7M7GTC0
Position
LG7:10695202..10732570
AA seq 994 aa
MMLVVYTGFTHDMTQSREVLAMMDAHTTTFGRKRGCTVSPCGAFLLGAAFLISLVVTGLL
VYHLAPCLEEKLDKSCNNASNSVSSRAFPTDTFGKKKLDVRLPRSIVPVSYELRLVPFIQ
VGNFTFNGEVKILVNVTEETDKVTLHAVDMRIDESFTNIKSYSAVKSAGEKVVKIVEQRN
DTERQFYVIRTLDTLRKGAQYIVNLKFVGHLNDYLQGFYRSSYTVGSETRWIATTQFQPT
DARRAFPCFDEPALKATFKISIARPKNMTSISNMPQMGEPMPVPGLPTYVWDHYERSVPM
STYLVAFIVSDFEMLKSESGKFRVWARSEAVQQARYTLDIGPKILRYYEDYFKIKFPLPK
MDSVALPDFSAGAMENWGLITCRETAMLYQEGVSTSSNQQRVATVIAHELAHQWFGNLVT
PSWWSDLWLNEGFASYMEYIGMNAVEPTWKVLEQFVVHDLQNVFGLDALESSHQISVKVE
HPDEISEIFDRISYEKGASIIRMMDHFLTTDVFKQGLTNYLNAKAYQSAEQNDLWDALTK
QAHKDKVLDPAVTIKEIMDTWTLQTGFPVVTVTRDYNNGAATLTQERFMLRNGTMVTTSN
VEPLWWIPITYTTESQLDFNTTQPSRWMKAEKSITLTNLNWNSSEWVIFNIQETGYYRVN
YDKTNWQLIIKQLNKNSFGNISTINRAQLIDDALNLARAGRLDYATALSVTSYLAHETEY
LPWKAAFTAMHYLDSMLIKMPSYDRFRVYVLKLLDNVYKQVGFTDNVGDPQLTVFTRIDV
LTWACNFGHEDCVQNAVKQFYNWRYTPSPNVNNPISPNLKMVVYCTAIRFGGQVEWDFAW
QRYLETNVGSEKDLLHHALGCTRETWLLSRYLDWTITNNSGIRKQDVSRVLNSIASNPVG
QPLAFNFLRNKWARLREYFGTSLLTINNIVKSATRGINTKYDLKDLIEFTNEHIGEFGSA
TRSVQQSIEQSEANIRWVEANHATIQDWLKRYTA
NT seq 2985 nt   +upstreamnt  +downstreamnt
atgatgctggtggtatatacagggtttacacatgatatgacccagtcccgggaggttttg
gcgatgatggacgcgcacacaacaacgttcggacgtaaaagagggtgcacggtctcccct
tgcggcgctttccttttgggcgccgccttcctcatatccctggtggtgaccgggctattg
gtttaccatctcgccccgtgcctcgaggagaaactcgacaaatcgtgcaacaatgcctcc
aactcggtgtccagccgcgcttttcccaccgacacgtttggaaagaagaaattggacgtc
agattgccgcgatccatagtcccggtctcttacgagcttaggctcgtgccgttcatacaa
gttggcaactttacgttcaatggcgaggtgaaaatcttggtgaacgtgacggaggagacg
gacaaggtgacgttgcacgcggtcgacatgagaatcgacgaaagtttcacgaatataaaa
tcttattcggccgtgaaatcggctggggagaaggtggtgaaaatcgttgagcagaggaac
gacaccgagcgccaattttacgtgattagaacgttggacacgttgaggaagggcgcgcaa
tacattgtgaatctaaagtttgtcggccatctgaacgactacttgcaaggcttctacagg
agctcgtacacggttggaagtgaaacgagatggattgcaacgactcaattccagccaacg
gatgcgcgacgcgcgtttccgtgcttcgacgagccggcgctgaaagccacgttcaagatc
agcatcgcgaggcccaagaacatgacatccatctcgaacatgcctcaaatgggagagccg
atgccagtgcccggtttaccgacgtacgtgtgggaccattacgaacgctccgtgccaatg
tccacttacctggtagccttcattgtttcggacttcgagatgttgaaatcggaatccggg
aagtttagagtctgggcacgaagcgaggccgtccaacaggcacgatacactttggacatt
ggcccgaaaatacttcggtattacgaggactatttcaaaattaaatttcctttgcccaag
atggacagcgttgccctccccgatttttcggctggagctatggagaattggggcttaatc
acttgcagggagacggctatgctgtatcaggaaggtgtctcgactagcagcaatcagcaa
cgagtggccacagtcatagcgcacgaacttgctcatcaatggtttggcaacttggtgact
ccaagttggtggtcggatctgtggttgaacgaaggctttgccagttacatggaatacatc
ggcatgaacgcggtggaaccaacgtggaaagttttggagcaatttgtcgtgcatgatctg
caaaacgtgttcggtctggacgcgttagaatcttcgcatcagatatcggtcaaagtggaa
caccctgacgaaattagcgaaattttcgaccgaatttcttacgagaaaggtgcttccata
ataagaatgatggatcatttcctcactaccgatgtgttcaagcaaggtttaaccaattat
ttaaatgcaaaagcttatcagagcgccgagcaaaacgatctttgggatgctcttacgaaa
caagcgcacaaggataaagtcctcgatcccgcggtaaccataaaggaaattatggatacc
tggaccctccaaactggtttcccagttgtaacggttactcgagattataataacggtgca
gctacgttgacacaggaacgcttcatgcttcgtaacggtactatggtgaccacgtccaac
gtcgagccactttggtggatacctatcacgtacacgaccgaaagtcaattagacttcaat
acaacccaaccttctcggtggatgaaagcggaaaaatcgatcacgttgaccaatttgaat
tggaattcctcggaatgggttatcttcaatattcaagaaactggatactacagagtgaac
tacgacaaaacgaattggcaactgataatcaagcaattgaacaagaactcgttcggcaat
atttcaacgatcaatcgcgcccaattaatagacgacgcgctcaatttggcaagagctgga
aggttagactacgccactgcgttgagcgtcacgtcgtatttagctcacgagaccgagtac
ttaccatggaaggctgctttcactgccatgcactatttggacagcatgttgatcaagatg
ccgagctacgatagatttcgagtatacgttttgaaactgctcgacaacgtgtacaagcag
gtcggtttcacggataacgtgggtgatccccaattgacagttttcacccgcatcgatgtt
ctaacatgggcatgcaactttggccacgaggattgcgtgcaaaacgcagtgaaacagttt
tacaattggcgctacacgcccagtccaaatgtgaataatccaatatcgccgaatttgaag
atggtcgtctattgtacggcgattcgtttcggtgggcaagtcgagtgggatttcgcttgg
caaaggtacttggagacgaatgtcggttccgagaaggatttgcttcaccacgcgctcggc
tgtacgagagaaacgtggctgctgagccgttacttggactggacgatcacgaacaattca
gggatcagaaaacaagatgtcagccgtgttcttaattccattgctagcaatcctgttggc
caacccctcgctttcaacttcctcagaaacaaatgggccagactccgagaatacttcggg
acatcgttattgaccataaataacatagtgaaatcagccacgagaggtatcaataccaaa
tatgatctcaaagatctaatagaattcaccaacgagcacataggggagttcggaagtgcc
acaagatcggtgcaacaatcgatagagcaatcggaagcgaacatacgatgggtggaagcc
aatcacgctacaattcaagattggttgaagagatataccgcgtag

DBGET integrated database retrieval system