KEGG   Apis mellifera (honey bee): 412919
Entry
412919            CDS       T01057                                 
Name
(RefSeq) TATA box-binding protein-like protein 1
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    412919
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ame03000]
    412919
   03021 Transcription machinery [BR:ame03021]
    412919
Transcription factors [BR:ame03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    412919
Transcription machinery [BR:ame03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     412919
  RNA polymerase III system
    TFIIIB
     412919
  RNA polymerase I system
    SL1/TIF-1B
     412919
SSDB
Motif
Pfam: TBP DddA-like PBP_sp32
Other DBs
NCBI-GeneID: 412919
NCBI-ProteinID: XP_396371
BEEBASE: GB45421
UniProt: A0A7M7TFJ7
Position
LG6:complement(16577079..16582285)
AA seq 305 aa
MATAIQKNGMKPLTNTSINHVEDVKNLNDTDICKEEKDERIFDGQIQPYMEAHEQEPREL
DIVINNVVCSFSVRCHLNLREIALNGSNVEYRRENGMITMKLRRPYTTASIWSSGKVTCT
GATSEVQAKIAARRFARSLQKLGFKVRFNNYRVVNVLGTCCMPFAIKITSFSSCHKENAD
YEPELHPGVTYKLKEPKATLKIFSTGSVTVTAPNVAAVQAAIEYIYPLVYEFRKERTAED
ELALTTKKRRLGMGLSKRNHDEFLHDPDYIYDTMFSDEEEEEEEEEEEEEEEEEEDEGES
DASWD
NT seq 918 nt   +upstreamnt  +downstreamnt
atggcaactgctattcaaaagaatggcatgaaacctttaacaaacacatcaataaatcat
gtagaagatgtaaagaatttgaatgatactgatatatgtaaagaagagaaagatgaaagg
atattcgatggacagattcaaccttacatggaggctcatgaacaggaacctcgtgaattg
gatattgttattaataacgtagtttgcagttttagtgttagatgtcatttaaatttacga
gaaattgcattaaatggatctaatgtggaatatagaagagaaaatgggatgataactatg
aaattaagaagaccttatactactgcttctatatggtcttctggtaaagtaacatgtact
ggtgcaacaagtgaagttcaagcaaaaattgcagctcgtcgttttgctcgttcccttcag
aaacttggatttaaagtacgatttaataattatagagtagtcaatgtattgggtacatgt
tgcatgccatttgcaatcaaaataacatcattttcatcatgtcataaagaaaatgcagat
tatgaaccagaacttcatcctggtgttacatataagttaaaagaaccaaaagctacattg
aaaatattttctactggaagtgttactgtaacagctcccaatgttgctgctgttcaagct
gcaattgaatatatctatccactagtctatgaatttcgtaaggaaagaacagcagaagat
gaacttgccttaacaacgaagaagcgtagactaggaatgggactaagtaaaagaaaccat
gatgagttcctacatgatccagattatatatatgatactatgttttctgatgaggaagaa
gaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagatgagggtgagagt
gatgccagttgggactga

DBGET integrated database retrieval system