KEGG   Apis mellifera (honey bee): 413012
Entry
413012            CDS       T01057                                 

Definition
(RefSeq) EH domain-containing protein 3
  KO
K12476  EH domain-containing protein 3
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ame00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    413012
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ame04131]
    413012
Membrane trafficking [BR:ame04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    413012
SSDB
Motif
Pfam: DUF5600 EF-hand_4 EHD_N Dynamin_N His_Phos_2 MMR_HSR1 EF-hand_1 GTP_EFTU EF-hand_6 AAA_28
Other DBs
NCBI-GeneID: 413012
NCBI-ProteinID: XP_026296675
BEEBASE: GB45735
AA seq 928 aa
MNEENKQKSCNNSQRNNVNTHIMVSILSIGIGSVLFAYVAFASTIGTQTSIQQVIFVFRH
GDRNPTETYPNDPYRNYEWQGGWGALTKDGMLRMYNIGQWIRTEYGSIIGNTYDSTLSLT
QSSYADRCIMSAQVLLAGLYPPTNEEIFVSGLTWRPVPVHSTPRNLDKMIVVKAPCPRLE
KALKEAYVNDSKSAEFPSSKYFQELSNYTGQNISTITDIEFLYNTLEIEERNGLKLPEWT
IKYYNRQMREIAARSLSLFTSNTLQQRLRGGPLLKEILERMNSFNNNQDTRRAYFYSAHD
ITLVNLLRTMGFTDEYFKPEYGSTLIFQLHAGSNSTEDMELKLMYLNDTKTLIPRSMDIP
KCGTPCLLKNLMKLWKNVLPDNWDNECLYSLLFKMFSWLTREESGKQDLFENVADGLKKI
YKSKLLPLEQHYQFHDFHSPQLDDPDFDAKPMILLVGQYSTGKTTFIKYLLERDFPGIRI
GPEPTTDRFIAVMYNEKEGVIPGNALVVDPNKQFRPLSKFGNAFLNRFQCSTVASPVLKG
ISIVDTPGILSGEKQRVDRGYDFTGVMEWFAERVDRIILLFDAHKLDISDEFRRLIEALR
GHDDKIRIVLNKADMIDHQQLMRVYGALMWSLGKVLQTPEVARVYIGSFWDQPLRYDVNK
RLFEDEEQDLFKDMQSLPKNAALRKLNDLIKRARLAKVHAYIISALRKDMPSVFGKDTKK
KELIKNLGQIYDQIQREQQISPGDFPDLKKMQEFLAHHDFSKFNTLKPKLLEVVDNMLVK
DIAQLMSMIPHEEIGTTSDLFVKGGAFEGVVDQVSPFGYKRGEGIDAGAGEPEWIVNKER
YKYNAIFEKLGPCDGKITGAAAKSEMVKSKLPNNVLGRIWKLSDIDKDGFLDSDEFALAM
HLINVKLEGYDLPAELPDHLIPPSKRNA
NT seq 2787 nt   +upstreamnt  +downstreamnt
atgaacgaagaaaataaacaaaaatcgtgtaataattctcaacgaaataacgtaaatact
cacatcatggtttcgatacttagtatcggtatcggttctgtattgttcgcgtatgtggca
tttgcttcaacgatcggtacacaaacttctatacaacaggtgatatttgtttttcgacat
ggagatcgtaaccctacggaaacttatccaaatgatccatatcgaaattacgaatggcaa
ggtggttggggagctttaacaaaggatggcatgctacgaatgtataacattggtcaatgg
attcgcactgaatacggctcgataattggcaacacatacgatagtactctatctctgacg
cagagtagttatgcggatcggtgtataatgtccgcgcaagttttattagcaggtttatat
ccaccaaccaatgaggaaatttttgtatcaggtttgacctggcgacccgtccctgttcat
tcgactcccagaaatttggataagatgattgtagttaaagcaccttgtccaagattagaa
aaagctttgaaagaagcatacgtgaacgattctaaaagtgcagaattcccatcaagcaaa
tactttcaagaactttctaattataccgggcaaaatatttcaacgattaccgatattgaa
tttttatacaacactttggaaattgaagaacgcaatggtttaaaattacccgaatggaca
atcaaatactataatcgacaaatgcgtgaaatcgcagctcgtagcttatccctatttacg
agtaatacattgcaacaacgacttcgcggagggccattgctcaaagaaattttggaacgt
atgaattcatttaataataatcaagatacaagacgagcatatttttattctgctcatgat
ataactctcgttaatttgttaagaaccatgggtttcacggatgaatacttcaaacctgaa
tatggatcgacgcttatttttcaattgcatgctggatccaattctacagaggatatggaa
ttgaagttgatgtatctaaatgatacaaaaacacttataccacgctctatggatatacct
aagtgtggtacaccttgtctgttaaaaaatttgatgaaattgtggaaaaacgtacttccc
gataactgggataatgaatgcttgtattcattactattcaagatgttcagttggttaact
cgggaagaaagcggtaaacaggatctctttgaaaatgttgctgatggcctcaaaaaaata
tacaaatcaaaattattgcctcttgaacaacattatcaattccatgattttcattcacct
caacttgacgatccagattttgatgcaaaacccatgattcttttggtgggtcaatattcc
acaggcaaaaccactttcatcaaatatttactagaacgagacttccctggaataagaatt
ggacctgaaccaacgacagatcgcttcattgcagttatgtacaatgagaaagagggtgta
atccctgggaatgctttagttgttgatccaaacaagcagtttcgtccactttctaaattt
ggaaatgctttccttaatagatttcaatgttctacggtcgcgtctcctgttttaaaaggc
atatctatagttgatacacctggtattttatcaggtgaaaaacaaagggtggacagaggt
tatgactttactggcgttatggaatggtttgccgaacgagtagacagaatcatcttatta
tttgatgctcataaacttgacatttctgatgaatttagacgtttgatcgaggcattacgt
ggtcatgatgataaaattagaattgttctcaataaagctgatatgattgatcatcaacaa
ctcatgagagtatatggagcattaatgtggtctttaggaaaagttttacaaactcctgaa
gtagctagagtatatattggctcgttttgggatcaacctttaagatatgatgtaaataaa
agattattcgaagacgaggaacaagatttattcaaagatatgcaatcattacctaaaaat
gcagcgcttagaaagcttaatgacttgattaaacgtgcacggttagcaaaggtgcatgct
tatataatcagtgctttaagaaaagatatgcccagtgtatttggtaaagatactaaaaaa
aaggaacttataaaaaatttgggtcaaatttatgatcaaatacaaagagaacaacagatt
tcacctggcgattttccagacttgaaaaaaatgcaagaattcttagctcatcatgatttt
agtaaattcaatactttgaaacctaaattgttagaagtggttgataatatgcttgttaaa
gatattgctcaacttatgagtatgattcctcatgaagaaattggtacaacatcagattta
ttcgtgaaaggcggtgcgtttgaaggagtagttgatcaagtgagtccatttggatataaa
cgaggggaaggtatcgatgctggtgcaggtgaaccggaatggatagttaataaggaaaga
tataaatacaatgcaatattcgaaaaactcggtccatgtgatggaaaaatcacaggtgca
gcggcaaaatcggaaatggtaaaatcaaaattaccgaacaatgtacttggaagaatttgg
aaattatccgatatagataaggatggatttctagattctgatgaatttgctttagcgatg
catttaattaatgtaaaactcgaaggttatgatctacctgcagaattaccagatcattta
ataccgccgtcgaagcggaatgcataa

DBGET integrated database retrieval system