KEGG   Apis mellifera (honey bee): 413034
Entry
413034            CDS       T01057                                 

Definition
(RefSeq) rho-related BTB domain-containing protein 1 isoform X1
  KO
K07868  Rho-related BTB domain-containing protein 1/2
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    413034
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ame04121]
    413034
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ame04031]
    413034
Ubiquitin system [BR:ame04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     413034
GTP-binding proteins [BR:ame04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoBTB
    413034
SSDB
Motif
Pfam: BTB Ras Roc TCL1_MTCP1 MAM
Other DBs
NCBI-GeneID: 413034
NCBI-ProteinID: XP_006560763
BEEBASE: GB49505
AA seq 737 aa
MDNEQPHQELVKCVVVGDTAVGKTRLICARACNKHVSLSQLLTTHVPTVWAIDQYRIYKD
VLERSWEVVDNVNVSLRLWDTFGDHEKDRRFAYGRSDVVLLCFSITNPVSLRNCKAMWYP
EIRRFCPQTPVLLVGCKNDLRYMYRDETYLSYFRDRSPFVRATRKSDLVMPDQARAVARE
LGVCYYETSVFTYYGVNEVFENSIRAALIARRQQRFWMTNLKRVQRPLLQAPFCPPKPVP
PEVCLAASTYEENMKTLWTKPVHTDVTLIAGNCTFSAHRCLLAAASPAFHRLFSMELVQE
QTPRSSSESSMVSTFGEATVGDFNDDTECLIRIDQSKPAKVWEQLKRRSSFQVLPTMDNQ
KKPTGTTRDLNHPAFQNIRVCLTENTNGMQQSTTVVTLSKLITPQAMQQCLQFIYTGSLD
KRYHDLQTAPIGLLLEIRQAAEFLELPQLLMVLGTLQTRDQFNNDLNNRYKQVVRQRLED
ICLEQGLFADVTFELDDGSVPAHKAILTARCDVMKAMFSGDFRESSAKVIVFPGVREYTF
HKLLCYLYTDEVPAISSARCLNLLELANRLCLPRLVNLVESRVIEDLERLSGNEGNEAVE
NCLRLLEPCKLHNADQLADWCMNYLCVNYNKLCKMSPRSVRLLHPENQEYLNEHRWPPVW
YLKDYDYYQKCLAERDRENKPTLKRNRNQSGCLCFSGTSKTRRESSSGGEGTASSANNDP
QSERPLFDSIESGEQVV
NT seq 2214 nt   +upstreamnt  +downstreamnt
atggacaatgagcagccgcatcaggaactggtcaagtgtgtggtcgtcggtgacacggca
gttggaaagaccaggctgatatgcgcaagggcctgcaacaaacacgtgtcactttcgcaa
cttttgacaactcacgtgcccaccgtttgggccatcgaccagtacaggatatacaaggac
gtcttggaacgatcctgggaagtagtcgacaatgtgaatgtctccctgcgactttgggac
acatttggtgatcacgaaaaagatcgacgtttcgcgtacggcagatcagacgtcgtgcta
ctatgtttctccataaccaatcccgtttcgctacggaattgcaaggcgatgtggtaccca
gagatacgacggttctgccctcagacccccgtgctgttagtgggatgcaagaacgatttg
cgttacatgtatcgagatgaaacttatttgagctattttcgtgatcgaagtccgttcgtg
agagccacgagaaagagcgatctggtgatgcctgatcaagctcgagccgttgcacgtgaa
cttggcgtttgttattacgagaccagtgtcttcacgtattacggtgttaatgaagtgttc
gaaaattcgatacgtgctgccttaattgcgaggcgtcagcaacgattttggatgacgaac
ttgaagagggtgcagagacctctgcttcaggcaccattttgtccaccgaaacctgttcca
ccggaagtgtgtctagctgcaagcacttatgaagagaatatgaagacactatggacaaag
cctgttcacactgacgtgactttaatagccggaaactgcacgttttccgctcataggtgt
cttttagccgctgcatcgcctgcatttcatcgacttttctctatggaacttgttcaagag
caaacacctcgaagttccagcgaatctagcatggtaagtacgtttggtgaagcaacggtc
ggtgattttaacgatgacaccgagtgcctgattcgtatcgatcaatcaaaacctgcaaaa
gtttgggaacaattgaagcgacgttcgagctttcaagtactgcccactatggacaaccaa
aagaaaccgactggtactaccagagatcttaatcatcctgccttccaaaacattcgtgta
tgtttgactgagaatacaaacggaatgcagcaatcaacgacagtggttacgctgtctaag
ttaattacgcctcaggcaatgcagcaatgtttgcagttcatttatacgggcagcttggat
aaacggtatcatgatctacaaacagctcctattgggcttctactggaaattagacaggca
gcggaattcttggagcttccgcaattgttgatggtgcttggaactctacaaactagagat
caatttaataatgatcttaataatcgctacaaacaggtagtgaggcaacgtttagaagat
atttgtctagagcaaggacttttcgccgatgtaacatttgaattagatgatggaagtgtt
ccagcccataaagcgattctcactgcccgatgtgatgtgatgaaagctatgttctccggt
gattttcgtgaaagcagcgcaaaagtaatagtgtttcctggtgtacgcgaatacacgttt
cataaactgctttgttatctctatacggatgaagtgccagcaatttcctctgccagatgt
ttgaacctcttagaattggcaaatcgtctctgcttaccacgactagtgaacttggtcgag
agcagagtaatcgaagatctcgagagattgtctgggaacgagggaaacgaggccgtggag
aactgtctgagattactggaaccgtgcaagttacataatgccgatcaactggccgactgg
tgtatgaattacttatgcgtgaattataacaaattgtgcaaaatgtctccacgaagtgtg
cgtcttctacatccagagaatcaagaatatttaaatgagcatcgatggcctccggtgtgg
tatttaaaagactacgattactatcaaaaatgtttagcggaacgagatcgggagaataag
ccaacgttaaaaagaaatcgtaatcagtccggttgtttatgcttttctggcaccagtaaa
actagaagagagagttccagcggtggtgaaggtacagcatcatcggcgaacaacgatcca
caatctgaacgacctttgttcgactcgatcgagtctggtgaacaggttgtatga

DBGET integrated database retrieval system