KEGG   Apis mellifera (honey bee): 413195
Entry
413195            CDS       T01057                                 

Definition
(RefSeq) alsin
  KO
K04575  amyotrophic lateral sclerosis 2 protein
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ame03036]
    413195
Chromosome and associated proteins [BR:ame03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    413195
SSDB
Motif
Pfam: MORN RCC1 VPS9 RCC1_2 PH
Other DBs
NCBI-GeneID: 413195
NCBI-ProteinID: XP_396645
BEEBASE: GB51745
UniProt: A0A088AJN0
AA seq 1536 aa
MEKHMHLWRGVDKLSYAFGDKPNGIICRLVTIKDHIFIATTTNNLYYGEVSFLENSSPSL
VFKRAQFDVIDIASNSDYLFIVDNNGHVLKVNPQDMTIIDTIILKEEVKCCSHGYKQENE
IVKVKSIAVSDQAALFVTENGQLWANGNQSQIDINSIEPKKVKFFEGRTVSAIACGSNFN
VVAVRKTTTALKNDTDSENELEEEVFVNSCPQCLNTVLLSPTSLTSSDTCPMGLHMQQFS
EDHSTNSISALSVASKEQETSFAESNKKEKNSEIVENGELCSNNPIDSDKEEKKNVIFIN
TEAARQFLTRQLSWVSSYGSVKEDIPLENIEKPTRLIKQNVSNVANLVYEGVKNVGGKVV
TLSRHMSGNSDINEFKDDSSEHLEVGEEYLKPATTSLALSLRCEEFPWSSSTGSSEHELS
QQGLNERINILTRTGNNILSTELWTWGDIEYGQLGTGDIVKRSRPILVAKLSNTGLRKIS
CGAFHVLALTLDGRVFAWGRNNYKQVTLEPYSYQSAPRLFTTKLFPNERAKDVTAGSFHS
LVMMHHGLYFIGHSSKTGEMFHLDIETNIKYSPQQIFSSGNYSCCSVINEPEINISEDLI
SDQIFLEEILVVYQNLIKPFQKKGGAMQESNVYETLCRCYTELLSFSALNVISLWDYFNH
IGEAYDVTVIANVEEYITVYKYYLNAVCDVISLSGFTYIAKIIEVPQIITNLFIDKLKTN
ETKKITDEIIITMALQHPLYKLNRYKNMILNLMKCNGTRMGIERMQEALIKWEQICDDQE
KQQKEAETTKLFWENSGKLGELLRSPDRRLIRESRTHPLSILNSGRFSTHWFVLLTDIFI
HVTGTSHMVHPLKTLWIEPLPDSETVQNAISVIAPEDTFVLYTPTPFDRNEWLYALQNAI
KCSLQRVIGHIPPVVRSSSFSFTKHSVFKDAKYTGRWLNGKPHGSGKLEWSDGRKYAGQF
HKGIIHGSGKMEIPSQGVYEGQWKDGQQNGYGTMKYNNGDFYEGYFKDGLPHGHGVKKEG
HFMASVASVYIGEWAAGVKQGYGIMDDIMTGEKYLGSWSNGMKHGCGLIVTLDGIYYEGF
FMQDVLTGHGVMVFEDGTHYEGEFKSAGIFYGKGTLTFTSGERLEGNMNGSWNEGVKVIA
TLHMNKANGNIQNYSKPISFGKLCVSPDQKWKAIFRQCYQQLGVPEPGSKTMSVVDKSAE
TQRVWQNIASIITKSHQKALQRKKHLTITSINKEKNNEVIDELDKIPCFGRDKLTIQNYS
EIHKYLIKAFDSSYHPLGALLTEVAAVYTATYGGVRVHPLLLSHAVSELRSITSRIYEIV
ILLFPALPRGGKEYVLETEKNEEESQVISAAAILHPILLPRVHSALFVLYALHNKKEDDA
YWERLMKWNKQPDITLMAFLDIDQKFWKNSNVMNLNENGLPYQNEPYFSEAIETLQQLKT
TFSPLEKLLVVRNTFEQMTQAVQKQLGTTYLWTMDELFPVFCFVVVRASVLQLGSEIHFI
EDFMEPYLQNGELGIMFTTLKACYYQILQEKINVGD
NT seq 4611 nt   +upstreamnt  +downstreamnt
atggagaaacacatgcatttatggagaggtgttgataagttatcatatgcttttggtgac
aaaccaaatggtataatttgtaggctagttactattaaagatcacatttttatagcaaca
actactaataatttatattatggagaggtttcatttttggaaaatagctctccgtcattg
gttttcaaaagagctcaatttgatgtgatcgacatagcatccaattcggattatttattt
attgtagataataatggacatgttttgaaagtaaatcctcaggatatgaccataatagat
acaataatcttaaaagaagaagttaaatgttgcagtcatggatataaacaagaaaatgaa
attgttaaagtaaaatcaatagctgttagcgatcaagcagcattatttgtaacagaaaat
ggacaactttgggctaatggaaaccaatcgcaaatagatattaatagcatagagcctaaa
aaagttaaattttttgaaggtagaactgtttctgctattgcatgtggttcaaattttaat
gtagttgcagtaagaaaaacaacaacagctttaaaaaatgatactgatagtgaaaatgaa
ctagaagaagaagtttttgtcaattcatgtcctcaatgtctcaacactgtattattaagt
cctacaagtttaacatcatcagatacttgtcctatgggacttcatatgcaacaatttagt
gaagatcattcaactaattctattagtgctttatctgttgctagtaaagaacaagaaact
tcatttgcagaaagtaataaaaaagaaaaaaattctgaaatagtagaaaatggagaactg
tgttccaataatcctatagattctgacaaagaagaaaaaaaaaatgttatctttataaat
acagaggctgcaagacaatttttaaccagacaattatcttgggtttcatcttatgggagt
gttaaagaagacatacctttggaaaacattgaaaaaccaactagattaataaaacaaaat
gtatctaatgtagctaatttagtatatgaaggagtcaaaaatgtagggggtaaagttgtt
acattatcaagacatatgagtggaaattcagatataaatgaatttaaagatgatagtagt
gaacatttggaagtaggagaagaatatctcaaacctgctactactagtttggctttaagt
ttacgctgtgaagaatttccatggtcatcaagtactggttcctcagagcatgaattgtct
cagcaaggtttaaatgaaaggattaatattttaactcgtactggtaacaacattttatct
actgaactttggacatggggtgatattgaatatggacaattaggaacaggagatattgtt
aaacgttcaagacctattttagtagcaaaactcagtaatactggattgagaaaaatttca
tgtggtgcatttcatgtacttgctctgacattagatggaagagtttttgcttggggcaga
aataattataaacaggtgacattggaaccatattcatatcaaagtgcacctcgtttattt
accacaaaattatttccaaatgaaagagccaaagatgtgacagctggtagttttcatagc
ttagttatgatgcatcatggtttatattttattggacattcaagtaaaactggtgaaatg
ttccatcttgatatcgaaacaaatattaaatatagtcctcaacaaatttttagttctggt
aattacagttgctgttctgtgataaatgaacctgaaataaatatttccgaagatttgata
agcgaccaaatttttttggaagaaatattggttgtttatcaaaatttaatcaaaccattc
caaaaaaaaggaggtgctatgcaagaatcaaatgtttatgaaacattatgtcgatgttat
accgaattattaagtttcagtgctttaaatgttattagtttatgggattattttaatcat
attggtgaagcatatgatgtaacagttattgctaatgttgaagaatatattactgtgtat
aaatattatttaaatgcagtgtgtgatgttatttctttgagtggatttacatatattgca
aaaataattgaagtaccacaaataataacaaatttatttatagataagttaaaaactaat
gaaactaaaaaaattactgatgaaatcattattacaatggcattacaacatccattatat
aaattaaatagatataagaatatgattttaaatctaatgaagtgtaatggtacaagaatg
ggtatagaacgaatgcaagaagctttaataaaatgggaacaaatatgtgatgatcaagaa
aaacaacaaaaagaagctgaaacaactaaattattttgggagaattctggaaaacttgga
gaattattaagatctcctgatagaagacttattagagaatcacgaacacatcctttatca
atacttaattctggaagattttctacacactggtttgttttattaactgatatatttatt
cacgttactggtacttctcatatggtacatccactcaaaactttatggatagaaccttta
ccagattctgaaacagtacaaaatgctatatcagtaatagcaccagaagatacatttgta
ttatacactccaacaccttttgatcgaaatgaatggttgtatgctttacaaaatgctata
aaatgtagtttacaaagagttattggacatatacctccagtagtacgttctagctcattt
tctttcacaaagcacagtgtttttaaagatgcaaaatatactgggcggtggctaaatggt
aaaccacatggttctggaaaattagaatggtctgatggacgtaaatatgcaggacaattt
cacaaaggtattattcatggttctggtaaaatggaaattccatcacaaggtgtatatgaa
ggacaatggaaagatggtcaacagaatggatatggaacaatgaaatataataatggagat
ttttatgaaggatattttaaagatggtttaccgcatggtcatggtgttaaaaaagaaggt
catttcatggcatctgtagcatcagtttacattggagaatgggctgcaggtgttaaacag
ggatatggaattatggatgatattatgacaggagaaaaatatttaggatcatggagtaat
ggtatgaaacatggttgtggtttaatagtaacgttagatggtatttattatgaaggattt
ttcatgcaagacgttttaacgggtcatggagttatggtatttgaagatggtactcattat
gaaggtgaatttaaatcagctggtattttttatggtaaaggaacattaacttttacaagt
ggtgaacgattagaaggtaatatgaatggttcatggaatgaaggtgtaaaagttattgca
acattacacatgaataaagctaatggaaatatacaaaattattcaaaaccaatatctttc
ggaaaattatgtgtatcgccagatcaaaaatggaaagctatatttagacaatgttatcaa
caacttggtgtacctgaaccaggttcaaaaactatgagtgtagttgataaatctgctgag
actcaacgtgtttggcaaaatattgctagcataataactaaatcgcatcaaaaagcttta
caacgaaaaaagcatctgacaattactagtattaataaagaaaaaaataatgaagtaatt
gatgagttagataagattccttgttttggaagagacaaacttactattcaaaactatagt
gaaattcacaaatatttaattaaagcattcgatagttcatatcacccattaggagcactt
ttaacagaagttgctgctgtatatacagctacctatggtggtgtaagagttcatccttta
ttgcttagtcatgctgtatctgaacttcgtagtattacttcaagaatatatgaaatagtt
atcttattatttccggcattaccacgaggtggaaaagaatacgtattggaaacagaaaaa
aacgaagaagaaagtcaagttataagtgctgcagcaatacttcatccaatattgttacct
cgtgtgcattcggcactttttgtactatatgctttacacaataaaaaagaagatgatgcc
tattgggaaagattaatgaaatggaataaacaacctgatataacacttatggcttttcta
gatattgatcaaaaattttggaaaaattcaaatgttatgaatttgaatgaaaacggatta
ccgtatcaaaatgaaccatacttcagtgaggcaatagaaacattacaacaactgaaaacc
acattttctccgttagagaaattattagtcgttaggaatacatttgaacaaatgacacaa
gcagttcaaaagcaattggggactacatatttatggacaatggatgaattgtttcctgtt
ttttgttttgtggttgttcgtgccagtgtattacagctgggtagtgaaatacattttata
gaagattttatggaaccctatttacagaatggagaacttggaattatgtttactactctt
aaggcctgttactatcaaatattacaagagaaaattaatgtgggtgactaa

DBGET integrated database retrieval system