KEGG   Apis mellifera (honey bee): 413197
Entry
413197            CDS       T01057                                 

Name
(RefSeq) G protein-coupled receptor kinase 1 isoform X1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04144  Endocytosis
ame04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:ame00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    413197
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    413197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ame01001]
    413197
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ame04147]
    413197
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     413197
Protein kinases [BR:ame01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   413197
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   413197
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Pkinase_fungal Kinase-like Kdo ABC1
Other DBs
NCBI-GeneID: 413197
NCBI-ProteinID: XP_026297911
BEEBASE: GB51749
Position
LG8:12466659..12490251
AA seq 652 aa
MDSVRSVMHKYLEKKKEVNFDKIFNQMFGYLLFKDYCENVAEEPIPQLRFYEEIKAYEKL
ECPEERRKLAKEIYDNFIMKELLAHSHEYSPEAVSHVHKYLMKNEVPVNLFEPYIEEIFN
HLRAEPFKKFLESEKYTRFCQWKNLELNMQLTMNDFSVHRIIGRGGFGEVYGCRKADTGK
MYAMKCLDKKRIKMKQGETLALNERIMLSAVSTGVDCPFIVCMTYAFQTPDKLCFILDLM
NGGDLHYHLSQHGVFNEREMKFYAAEVILGLEHMHRRYIVYRDLKPANILLDEHGHVRIS
DLGLACDFSKKKPHASVGTHGYMAPEVLSKGVTYDSSADWFSFGCMLHKLLKGHSPFRQH
KTKDKHEIDHMTLTKNVELPETFSRELRSLLEGLLQRDINNRLGCRGAGADELKEHPFFS
GIDWQQVYLQKYTPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLTDADQELYKNFPLTIS
ERWQAEVAETVFETINNEADKLENKKKAKQKQRFDADEKGSDCILHGYIKKLGGPFASAW
QTRYAKLYPNRLELHPESTTKPELVFLDQVEEVSADFQHVKGEQCIVVRMRDAKIVLTNP
DEISLKEWALSLRSAHKCSMEMLGSMAKKAGKIYGTERDAVIPAMQRSTNGN
NT seq 1959 nt   +upstreamnt  +downstreamnt
atggatagtgtgagaagcgtaatgcacaaatatctggaaaagaagaaggaagttaacttc
gataaaatattcaatcaaatgtttggttacctcttattcaaagactactgcgagaatgtg
gcggaggagccgattccgcaacttaggttttacgaagagatcaaggcgtacgagaaactc
gaatgcccggaagagaggagaaaacttgccaaagagatctacgacaatttcatcatgaag
gagctgctggcacactcccatgaatactcgccggaagcggtgtcccacgttcataaatac
cttatgaaaaacgaggtccccgttaatttgttcgagccgtatatcgaggagatttttaat
cacttgagagcggaaccgttcaaaaagtttctcgagagcgagaagtacacgcgattttgt
caatggaaaaacttagagttgaacatgcagctgacaatgaacgacttcagtgtacatcga
ataataggaagaggcggatttggagaagtttacgggtgtcgaaaagcagacacggggaaa
atgtacgcgatgaaatgccttgacaaaaaacgaataaaaatgaagcaaggcgaaacttta
gcgctcaacgaaaggataatgctttcggcagtcagtaccggagtcgattgtccatttata
gtatgcatgacgtacgccttccaaacgccggacaaactgtgcttcattctggatctgatg
aacggtggcgatcttcattaccatctaagtcagcacggagtgttcaacgagcgagagatg
aagttttacgcggcagaagtgatattgggattggagcacatgcaccgtagatacatcgtt
tacagagacctgaaacctgccaatatccttctggacgagcatggccatgtcagaatatcg
gatttggggttggcttgcgatttctccaaaaagaaaccgcatgcaagcgtagggacgcac
gggtatatggcaccggaagtgctttcgaaaggtgtaacctacgactccagcgccgattgg
ttctcgttcggttgtatgctgcataaattgttaaaaggtcatagtccattcagacagcat
aaaacaaaagacaaacatgaaatagatcacatgacattaaccaagaacgtagagctgcca
gaaacgttctcacgagaattgcgctcattgctggaaggtctgctacaacgagatatcaac
aacagacttggatgtcgaggtgcaggtgcggacgagttaaaagaacacccgtttttcagt
ggtatcgattggcaacaagtttatctccagaaatacacgccaccgcttataccaccgcgc
ggcgaggtgaacgccgcagatgcctttgatatcggctcctttgacgaggaagacactaag
ggtatcaaattgacggatgcggatcaagaactgtacaaaaatttccctctaaccatctcg
gagagatggcaagctgaggtagccgaaactgtgttcgagacaatcaataacgaagctgac
aagttggaaaataagaaaaaagctaaacagaaacagcgattcgacgcggatgaaaaagga
tctgattgcattttacacggttatattaaaaaattgggtggtcctttcgcaagtgcatgg
caaacgcgttacgcaaaattgtatcctaatagattagaattgcatccagagtccacgaca
aagcctgaacttgtttttcttgaccaggttgaggaagttagcgcggattttcagcacgtg
aaaggggaacaatgtattgtcgtccgtatgagagacgcaaaaatagtacttacaaatcca
gatgagatcagtttgaaagaatgggcgttgtcattgagatccgcgcataaatgttcaatg
gaaatgttgggcagtatggcaaagaaggccggtaagatctacgggactgaaagagacgca
gtaattcctgcaatgcagcgctcgacgaatggcaactag

DBGET integrated database retrieval system