KEGG   Apis mellifera (honey bee): 413376
Entry
413376            CDS       T01057                                 
Name
(RefSeq) E3 ubiquitin-protein ligase TRIM37 isoform X5
  KO
K10608  tripartite motif-containing protein 37 [EC:2.3.2.27]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    413376
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ame04121]
    413376
Enzymes [BR:ame01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     413376
Ubiquitin system [BR:ame04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    413376
SSDB
Motif
Pfam: zf-B_box MATH zf-C3HC4_3 zf-C3HC4_2 PIN_8
Other DBs
NCBI-GeneID: 413376
NCBI-ProteinID: XP_016766683
BEEBASE: GB46878
UniProt: A0A7M7IJ15 A0A8B7KHP2
Position
LG3:4315591..4321488
AA seq 1010 aa
MTDRMASRETSINSKNSDDHSVETLAEVFRCFICMEKLTDAHLCPHCSKLCCYTCIRRWL
TEQRSQCPHCRASLLLHELVNCRWVEEVTQQLDTLQAVGISNSRHDDSSRDRCTVHREKL
SVYCWTCRRCICHQCALWGGTHSGHTFKPLEEVYEQHVTQIKAEVGQLKRRLMELISLVQ
EVERNVESVRAAKDERVREIRNAVELMIARLDSQLKAKLLTLMSQKNSLTLETEQLEALL
QEVEHQLHTCTRSELIIKSADLSRMIHQVRKKPMTSFVTAPVPADFHSEIVPGYDSATFA
MQNFTQLQLKADPVYSAPLHVNGLCWRLKVYPDGNGVVRGNYLSVFLELSAGLPETSKYE
YRVEMIHQGSRDTSKNIVREFASDFEIGECWGYNRFFRLDLLATEGYLNTELDTLILRFQ
VRPPTFYQRCRDQQWYISQLLTVQNQYATQINELKERLAIEISRNAMAVTRVPSGATLCG
STSNVTPMIMQQQSQTAGDSLVNSNSTRSGETYQNSTSTRSVQNVLPGGSNSDVLSGDQL
MPMCELGEPSNMRPLGSSSTLSSISSKTSLKQHRVNNLSVVEAEPPNMHSTNDNSVGDCP
ATSAHSPPPSYSSPTVNQQQLNLLSSSSSSDSGELSEHDIYLDECEHNEPHLTLLDDNSN
DENDVDDETMSGENDVEVAESLSAWIQNKQRTKQQNNRESTGDIWRLGGTDSLEDEIMLQ
LFEMQDRNSAWTSLCFNQHVDDTCDSRTSLIAIQHHNSNPLQPEHDSTCNEQFADKRSTC
PSHLCQPQMICSGRSKLSQLPNICQQEISGLIACGSQTRSEPATRSNSIDCEKELPKISM
VNKVNHEVEISRSDLIVPNVVLDSNKIVSKHLLSRRQSSPSSSTNVSIINNENSKIFEFE
QLLETIQLSPISQKDTASCFNKLRKNIPLEGKSNGCVTASIKSTALSLGHDVSLSSTSST
DAIPSSNNYSWAPALYQHKHGQKNILEATASSNDTSNKCTAEKSLEETNS
NT seq 3033 nt   +upstreamnt  +downstreamnt
atgactgacagaatggctagtagagaaacatcaattaattcaaaaaactcggatgatcat
agtgtagagacattagcagaagtcttcaggtgttttatttgtatggaaaaattgacagat
gcacatctttgtcctcattgcagtaaattatgttgctacacatgtatcagaagatggtta
acagaacaacgttctcaatgtcctcattgtagagcttccttacttttacatgaattagta
aattgtagatgggttgaagaagtaacacaacaacttgacacacttcaagctgttggtatt
tcaaattctaggcacgatgattccagtagagataggtgtactgtgcaccgtgagaaactg
tctgtttattgctggacttgtcgtagatgtatatgtcaccaatgtgctctttggggtggc
actcattcaggacatacttttaaaccattagaagaagtttatgaacaacatgttacacaa
ataaaagcagaagtaggtcaattaaaaagaagattgatggagttaataagccttgttcaa
gaagtagaacgaaatgtagaatctgtaagagctgcaaaagatgaaagagttagagaaatc
agaaatgcagtagaattaatgatagcacgtttagattctcaattaaaagctaaattatta
acgttaatgagtcagaaaaactctttgacactagaaacagaacaattagaagcattatta
caagaagtagagcatcaattacacacttgtactcgttctgaacttataattaaaagtgca
gatctttcgcgaatgatacatcaagtacgaaagaaaccaatgactagttttgttactgct
cctgttccagcagattttcatagcgaaattgttcccggatatgatagcgctacatttgca
atgcaaaattttacacaattacaattaaaagcagatccagtatattctgcacctttacat
gttaatggattatgttggagattaaaagtatatcctgatggaaacggtgttgtacgcgga
aattatttatctgtttttctagaactaagtgctggtttgccagagacatcaaaatatgaa
tatagagtagaaatgattcatcaaggatctcgtgatacaagtaagaatattgttcgagaa
tttgcttctgatttcgaaattggtgaatgctgggggtacaatagatttttcagactagat
ttgcttgcaactgaaggatatttaaataccgaattggatactcttatattgcggtttcaa
gtacgtccaccaacgttttatcagcgttgtcgagatcaacaatggtatatcagtcaatta
cttacagttcaaaatcaatatgctacacaaattaatgaattaaaagagagattagcaatt
gaaatatcacgaaatgctatggcagtaacccgagtacctagtggagcaactttatgtgga
tcaacatcaaatgtgacacctatgattatgcaacaacaatcacaaactgctggtgattca
ttagttaattccaattctactcgttcgggtgaaacatatcaaaatagcacatccacaaga
tcagtacaaaatgtacttcctggtggaagtaacagtgatgttttatctggagatcaatta
atgcctatgtgtgaattaggagaaccttcaaatatgcgtcctcttggttcttcttcgacg
ttatcttctatttcatcaaaaacaagtttaaaacaacatagagtaaataacttaagcgtt
gttgaagctgaaccacctaatatgcatagtacgaatgataattctgtgggagattgtcca
gctacaagtgctcattctccacctccttcatattcttcaccaacagttaatcaacaacaa
ctgaatcttttgtctagtagcagcagtagtgatagtggagaattaagtgaacatgatata
tatttggatgaatgtgaacataatgaaccacatctaacacttttagatgacaattctaac
gatgaaaatgatgtagatgatgaaacaatgtcaggagaaaatgacgtagaagttgccgaa
tcattatcagcatggattcagaataaacaacgtacaaaacaacagaataatcgagaaagt
acaggagatatttggagattaggaggtactgatagtttagaagatgagattatgttgcaa
ttatttgagatgcaagatcgaaattctgcttggacttcattatgttttaatcaacatgta
gatgatacttgtgattcaagaacatctttaattgctatacaacatcataattctaatcct
ttacaaccagaacatgattcaacatgtaatgaacaatttgctgataaacgttctacatgt
ccttcacatctttgtcaacctcaaatgatatgtagtggtagatcaaaattaagtcaatta
cctaatatttgtcagcaagaaatttctggattaatagcttgtggaagtcaaacaagatct
gaacctgcaactcgttcaaattcaatagactgtgaaaaagaacttccaaagatatctatg
gttaataaagttaatcacgaagtagaaatatctagatctgatttgatagtgccaaatgta
gtactggatagtaataaaatagtatcaaaacatttattatcacgacgacaatcttcgcca
tcatcgtctactaatgttagtattataaataatgaaaatagcaaaatatttgaatttgaa
caattgttggaaactattcaattatctccaatatctcaaaaagatactgccagttgtttc
aataaattaagaaaaaatattccattagaaggaaaatctaatggttgcgtcactgccagt
ataaaatctactgcactttctttaggacatgatgtttcattatcgtccacaagcagcaca
gatgctattccgagttccaataattatagttgggcacctgcattatatcaacataaacac
ggtcagaaaaatattttagaggctactgcatcatctaatgatacttccaataaatgtacc
gcggaaaaatcattagaagaaactaattcgtga

DBGET integrated database retrieval system