KEGG   Apis mellifera (honey bee): 413448
Entry
413448            CDS       T01057                                 

Name
(RefSeq) raf homolog serine/threonine-protein kinase Raf
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04013  MAPK signaling pathway - fly
ame04068  FoxO signaling pathway
ame04150  mTOR signaling pathway
ame04214  Apoptosis - fly
ame04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:ame00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    413448
   04068 FoxO signaling pathway
    413448
   04150 mTOR signaling pathway
    413448
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    413448
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    413448
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ame01001]
    413448
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     413448
Protein kinases [BR:ame01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   413448
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like Pkinase_fungal ABC1 zf-RING-like C1_2 Kdo
Other DBs
NCBI-GeneID: 413448
NCBI-ProteinID: XP_396892
BEEBASE: GB49120
UniProt: A0A7M7R8I0
AA seq 715 aa
MSSSRGSGPESGELSDSEDGYLDTDPLRYELRNIQNVIHVTRQNIDALNNRFAGFQHPPS
IYLNEYQELTSKLHDLESKEQKLNELLNAGRVSGSASTSESESRDANASIRGQRTPMKSL
LRAYLPNQQRTSVQVREGLSLRDALAKAMKLRNLTTEMCVVYILGADNSRYLTSWDTDIS
LLDCDEISVEILDKFPITTSISHNFVRKTFFSLAFCECCRKLLFQGFYCRTCNYRFHQRC
AGGVPALCHQVRMQDAYYQALLAHNLESTAGILQLPSGYGLSRSMSPSLAPSRNQRHPRS
LGQQDRSSSAPNVCFNMVKPSGEAANIDEYTRSQSLGRPIGTTQSAVSPGSSPTKHSQST
QASPTSTLRPKRPRARSADESSKNLLAPRESIEDWEIPADEILIGARIGSGSFGTVYKAH
WHGPVAVKTLNVKIPTAAQLQAFKNEVAVLRKTRHVNILLFMGCVSKPQLAIVTQWCEGS
SLYKHLHVFETKFDLFTLIEIGRQTAQGMDYLHAKNIIHRDLKSNNIFLHDDLTVKIGDF
GLATAKTRWSGSQQFHQPTGSILWMAPEVIRMQEENPYSFQSDVYAFGVVLFELLSGQLP
YSHINNKDQILFMVGRGNLRPDLNKLRSDTPKALKRLTEDCIKFSREDRPIFRQILANLE
SLLRGLPKITKSTSEPNLNRTQLQSDDFVYTCASPKTPVNFQFGAFSFYPSGGNI
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgtcctcttcacgaggtagcggcccggaatcgggagaactcagcgattccgaggacggt
tatttggatacagatccattaaggtatgagctgagaaatatacaaaatgtgatacacgtt
actcgacaaaacattgacgctctgaacaatcgttttgctggatttcaacatccaccttcg
atatatttgaatgagtatcaagaattaactagcaagttgcatgatttagaatctaaggaa
cagaagctcaatgaattgttgaatgctggtcgagtatctggtagtgcttccacatcagag
agtgaatctcgtgatgctaatgcatctattagaggtcaaagaacgccaatgaaatctctg
ctcagggcatatttacctaatcaacaacgtacaagtgtacaggttcgtgaaggactttca
ttaagagatgcacttgccaaagcaatgaaattacggaatttaactacagaaatgtgtgtg
gtatatattttgggtgcggacaactccagatatcttacttcttgggataccgacatctca
ttgcttgactgcgatgaaatatctgtggaaattttggataagtttccaataactacttcc
atttctcataactttgtgcgcaagactttcttctcactagcattttgtgaatgttgtaga
aaactcctttttcagggattttattgtagaacttgcaattatcggtttcatcaaagatgt
gctggtggtgtacctgctttatgccaccaagtacgtatgcaagatgcttattatcaagca
ttgctagcacataaccttgaaagtactgctggaatattacaacttccttctggatatgga
ttaagtagaagcatgtctccatctcttgctccatcaagaaatcaaaggcatccacgttct
ttgggacaacaagatcgttccagttctgcgcctaatgtttgttttaatatggtaaaacca
agtggagaagctgctaatatagacgaatacactagatctcagagtttaggtcgtcctatt
ggtactacacaaagtgcagtatcacctggtagcagcccaacaaaacatagtcagtcaaca
caggctagtcctactagtaccttaaggccaaaaagaccaagagcaagatcagctgatgaa
tcatctaaaaatcttttagcacctagagaatccatagaggattgggaaattccagcagat
gaaattttgattggagctcgtattggatcaggttcttttggaacagtatacaaagctcat
tggcatggccctgtagctgtaaaaacactcaatgttaaaatacccactgctgctcagtta
caagcatttaaaaatgaagttgcagttttacgtaaaacacggcatgtaaatattcttttg
tttatgggatgtgttagcaaaccacaactagcaattgttactcaatggtgtgaaggttct
tcgttatataaacatttacatgtatttgagacaaagtttgatttattcacattaatagaa
attggaagacaaactgcacaaggaatggattatttacatgcaaaaaatatcattcatcga
gatttaaagagtaataatatatttttgcatgatgatctcactgtaaaaattggagatttt
ggtttagctacagcaaaaactaggtggtctggttctcaacaatttcatcaaccaactgga
tccattctttggatggcaccagaagttataagaatgcaagaagaaaatccatatagtttt
caatctgatgtttacgcattcggtgtggttttatttgaattattatctggccaactacca
tattcgcatattaataacaaagatcaaatattatttatggttggacgtggaaatttacgt
ccagatttaaataaattgcgatcagatactcctaaagcactgaagagactgacagaggat
tgcattaaattttccagagaagatagaccaatatttcgtcaaattttagctaatttagaa
agtcttttacgaggattacctaaaataaccaaatcgacatctgaaccaaacttaaacagg
acgcagctacaatcagatgattttgtatacacttgtgcttcgccaaaaactccagtgaat
ttccagttcggagcattttccttttatccttccggtgggaacatataa

DBGET integrated database retrieval system