KEGG   Apis mellifera (honey bee): 413567Help
Entry
413567            CDS       T01057                                 

Definition
(RefSeq) L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00040  Pentose and glucuronate interconversions
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    413567
Enzymes [BR:ame01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     413567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase RmlD_sub_bind THF_DHG_CYH_C NAD_binding_10 TrkA_N Polysacc_synt_2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 413567
NCBI-ProteinID: XP_397008
BEEBASE: GB55220
UniProt: A0A0B4J2P7
AA seq 244 aa AA seqDB search
MNINFVGKRILVTGAGRGIGKDLALRLSKYEGQVIALSKKKENLDKLCKEDPRIQFICVD
LSDWNATRKAVESVLPIDLLVNNAGVAHLNSFFDATPEDFDLTFTVNVKAILNVSQIVAK
NMIERKVGGSIVNISSQASQAALKDHVVYCASKGAVDMLSKTMALELGPYNIRVNTVNPT
VILTEMGKLGWSDPKKARTMLDKIPLGRFGEVSEVVDAIVYLLSNHSSMINGITLPVDGG
FLAT
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaattttgtgggaaaacgtattcttgtaacaggagctggacgaggtattggc
aaagatttagctcttcgtctttccaaatatgaaggtcaagtaatagcgttgtccaagaaa
aaagagaatctagataagctatgtaaagaagatcctcgtattcagtttatttgcgtcgat
ctcagcgattggaacgccaccaggaaagccgttgaaagtgtgttacctatagatctctta
gtaaataatgccggtgttgcacatcttaattctttcttcgatgctacaccagaagatttt
gatttaacatttacagtaaatgtgaaagctatattgaatgtttctcagatagtcgcaaaa
aatatgattgaaagaaaagttggtggtagtattgttaatatttcttcgcaagccagccaa
gcagctttgaaggatcatgttgtctattgcgcttcgaaaggagcagtagatatgttgtct
aaaacaatggctcttgagcttggtccctataatattcgagtgaataccgtgaatcctaca
gtgattttgacggaaatgggaaaattaggttggagtgatccgaaaaaagcacgaactatg
ttagacaaaataccattaggtcgattcggcgaagtgtccgaggtagtggatgcgatagtg
tatttattaagcaatcacagctcgatgattaatggaattacattgccagtggatggtgga
tttttagcaacataa

DBGET integrated database retrieval system