KEGG   Apis mellifera (honey bee): 413643
Entry
413643            CDS       T01057                                 

Definition
(RefSeq) N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein
  KO
K03857  phosphatidylinositol N-acetylglucosaminyltransferase subunit A [EC:2.4.1.198]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    413643
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ame01003]
    413643
Enzymes [BR:ame01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.198  phosphatidylinositol N-acetylglucosaminyltransferase
     413643
Glycosyltransferases [BR:ame01003]
 GPI-anchor biosynthesis
  Core oligosaccharide
   413643
SSDB
Motif
Pfam: PIGA Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_4_2 Glyco_transf_5
Other DBs
NCBI-GeneID: 413643
NCBI-ProteinID: XP_397085
BEEBASE: GB41759
UniProt: A0A087ZSH3
AA seq 442 aa
MNSIKHKICMVSDFFYPNMGGVEEHIFNLSQCLLERGHKVIVLTHSYGDRIGIRYMTNGL
KVYYIPVKVFYNQCVLPTMICSIPLIRYIYLREEIQIVHGHSAFSALAHEGMLIGRLMGL
KTIFTDHSLFGFADASAILTNKFLEISLADCNHCICVSHTGKENTVLRAKVLKEKVSVIP
NAVDTTLFMPDINKRDDNFITIVIVSRLVYRKGVDLLARIIPNLCSRYQDVQFLIAGDGP
KRWLIEEVRERNLLQHRVTLLGSLKHSQIRHVLNKGHIFLNTSLTEAYCMAIVEAASCGL
QVVSTKVGGIPEVLPPDLIYLVEPTVPALIEGLESAITDYKEGNIKCPMEMHKKISLFYN
WFNITKRTEVVYNLVKQESNKNLGQQLVSYIQSGVLPYLLVISLCYIILQILEILVPRKY
IDVAKEYTETDVINPQEKIKEN
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgaacagcataaaacataaaatatgtatggtatctgatttcttttatcctaatatgggt
ggtgttgaagaacatatttttaatttatctcaatgtttattagaacgtggacataaagtt
atagtgcttactcattcctatggtgatagaattggaatacgttatatgacaaatggttta
aaagtatattatataccagtaaaagtattttacaatcaatgtgttcttcccacaatgatt
tgttctattcctctcattagatatatttatttaagagaagaaattcaaatagtgcatggt
cattctgcattctctgctcttgctcatgaaggaatgttaattggccgtttaatgggactg
aaaactatttttacagatcattcactttttggctttgcggatgcatctgcaattttaaca
aataaatttttagaaatatcattagccgattgcaatcattgtatatgtgtatcacatact
ggaaaagaaaatacagtattaagagcaaaagttttaaaagagaaagtttctgttattcca
aatgcagttgatacaacattatttatgcctgatattaataaaagagatgataattttatt
acaatagtcattgtatcgcgattagtatatcgcaaaggtgtcgatttattagctcgcatt
atacccaatctttgtagtcgatatcaagatgttcaatttttaattgctggtgatggtcct
aaaagatggcttatagaagaagtacgagaaagaaacttattacaacatagagttacatta
cttggaagtttgaaacattctcaaattagacatgtattaaataaaggacatatatttctt
aatacaagtttgacagaagcatattgtatggcaattgttgaagctgcatcatgcggttta
caagttgtttcaacaaaagttggtggtatacctgaagtattacctcctgatttaatttat
ttagtagaacctacagtacctgctcttattgaaggattagaatctgctattacagattat
aaagaaggtaatattaaatgtccaatggaaatgcataaaaaaataagtttattttataac
tggtttaatattactaaaagaacggaagtagtatacaatttagtaaaacaagaaagtaat
aaaaatttaggtcaacaattagtaagctatattcaaagtggagtattaccttatttactt
gtcatatctttatgctacattattttacaaattttagaaattcttgtacctcggaagtat
attgatgttgcaaaagaatacactgaaaccgatgtcataaatcctcaagaaaaaataaaa
gaaaattaa

DBGET integrated database retrieval system