KEGG   Apis mellifera (honey bee): 413666
Entry
413666            CDS       T01057                                 
Name
(RefSeq) peroxisome biogenesis factor 1 isoform X2
  KO
K13338  peroxin-1
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    413666
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ame04131]
    413666
Membrane trafficking [BR:ame04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    413666
SSDB
Motif
Pfam: AAA PEX-1N AAA_lid_3 AAA_16 AAA_22 AAA_18 RuvB_N AAA_2 AAA_5 AAA_14 TIP49 Viral_helicase1 Zeta_toxin TsaE NACHT Mg_chelatase Bac_DnaA MazE_antitoxin AAA_17 DUF815 RNA_helicase AAA_24 AAA_33 DUF2075 Parvo_NS1 KAP_NTPase AAA_28 IstB_IS21 AAA_3 NB-ARC Cytidylate_kin2
Other DBs
NCBI-GeneID: 413666
NCBI-ProteinID: XP_006566367
BEEBASE: GB45107
UniProt: A0A8B6Z690
Position
LG11:11157983..11165366
AA seq 986 aa
MSCNVRPNLNESLCIGTTFARSLNIEEGDEVIVSFVKNVPILIKINVAPLTVNDREILEL
QIEKVQSTLLSQIRVVVEGQPIVAWVSRFSYVTLIVESLEPPVKYGKLEQFSEIHVADTA
MNKKDDDWNEKNGKKTSSIANNLLSAFKKFLPITNDRNSIKEREDEAIRNYELLHSFSNR
KLPMICRVHPMPKMDTIEGNTFDEIARCPYHVFVPSDQASEFLENFAIARIKKLPEDKQY
VNVTNTSFLVKDESPVPNLFTELVVRVYTLEDLLEKTSTLNEEHFNINLRHKSVYVSDSL
RISLKLKVGSKVSLTLMDRTEISVPSSLELFSWRDSVSVKDFEDYVKKYSSLHNKLLINS
CAVIVMDNGSSCIVKISSEDCKFAVIDEAALRDTKVRVRSVEEKDQFPVFDKLDQEYSRL
EKTYTSHLTTILTECQLALDLSLGLQTQLPFEYNPENILISGVVGSGKTATCKIIEDIMR
SPPYFVHTHTIDCRSLKGKKVEMLQKIIMAALSECVYYQPSILFLDDIEAITNASMNDEE
NTPDAINAARITDMLNNTVMQYQESYQVSIIATCASINRIGQKLRPARGCHFFRTVLSIP
NLEKADRINILQLMLGDKLYTAGDVNWDYYGNKTEGWVFQDLVDMAKKATFAAWKRHDSS
KPPIVIEEEDMEAALKNYTPMSLQDVQLYKGTGHVWSDIGGLADVKRSLVEILQWPLKYP
EIFKNAPIKLQNGILLYGMPGTGKTMLAKAIANECGVNLISVKGPELLSKYIGVSEESVR
NVFERALRAKPCVLFFDEFDSLAPRRGHDSTGVTDRVVNQLLTQMDGVEDREGVAVVAAS
SRPDLLDPALLRPGRLDKALYCPLPDEADRKEILTALCKRQKVDTTGLDLKELATLTSGF
TGADLNAVVTQARLSALENAIANVSDGKIEAGDIKVSQTHLIDSINSTHPSLPRAEKEKY
KRIYAKFAKNDNFVEDITKNQKATLA
NT seq 2961 nt   +upstreamnt  +downstreamnt
atgtcatgtaacgtaaggccgaatcttaatgaaagtttgtgcattggtacaacttttgca
agaagtttgaacatcgaagaaggtgacgaagtaattgtatcgttcgtgaagaatgttcca
attttaataaaaataaatgtcgcacctctcaccgtgaacgatagagaaattttggaatta
caaatagaaaaggtacaatctacattgcttagtcaaatacgagtggtagtagaaggtcaa
ccgatcgtagcttgggtttcaagattttcttacgtaaccttaatcgtagaatcgctggaa
ccaccagtgaaatatggcaaactcgaacaattttcggaaatacacgttgccgatacggca
atgaataaaaaggacgacgattggaatgaaaaaaacggcaaaaagacatccagtatcgcg
aacaatttgctttcggctttcaaaaaatttttaccgattacgaatgatcgaaattcgatc
aaggaaagggaagatgaagcgatccgaaattacgagctattgcatagttttagcaacaga
aaattacccatgatatgccgtgtccatccaatgcccaaaatggatacgatcgaaggaaat
acgttcgacgagattgctcgttgtccttatcacgtgttcgttccgagtgatcaagcgtcg
gaatttttggaaaattttgcgatagctcgtataaaaaaacttccagaggacaagcaatac
gtgaacgtgaccaacacgagtttccttgtaaaagacgagtcccctgttccaaaccttttt
acagaattggtagtgagggtgtacacgttggaggatttgttagagaaaaccagcacgttg
aacgaggaacattttaacattaatttacgtcacaagagcgtgtacgtgtcggacagtttg
agaatcagtttgaagttaaaagtaggttcaaaggtgagcttaacgttgatggatagaact
gaaatatctgtaccgtcctcccttgaattattttcgtggagagattcggtatcggtgaaa
gatttcgaggattacgttaaaaagtattcttcccttcataataaattgttgattaactct
tgtgctgttattgtaatggataacgggagttcttgtatagtgaaaatttcatcggaggat
tgcaagtttgccgtgatcgacgaggccgctttaagggatacgaaggtgcgtgtgaggtcg
gtggaggaaaaggatcagtttccagtatttgacaagttggatcaagaatattctcgttta
gaaaaaacgtatacgagtcacttgacgacaattttaacggaatgtcaactagcgttagat
ctcagtctaggcttacaaacacaattaccttttgaatacaatcctgaaaatattttaatt
tctggcgtggttggttcgggcaaaactgccacttgcaaaataatcgaggacattatgcga
agtcctccgtatttcgtgcacactcacacgattgattgtagatcgttaaaagggaagaaa
gtagaaatgttacaaaaaattattatggctgctctgtccgaatgtgtctattatcaacct
tcgatattatttctggacgatatagaagccataacgaatgcatcgatgaacgatgaagag
aacacaccagatgctataaatgctgccaggataacagatatgctgaataacacggtgatg
caatatcaagaatcatatcaagtgtcaataattgcaacgtgtgcaagtattaacaggata
ggacagaaattaaggccggctaggggttgtcattttttcaggactgttttatctattcct
aatttagaaaaggcggatagaatcaatattttgcaattaatgctcggagataagttgtac
acggctggagacgtgaattgggattactatggaaacaagaccgaagggtgggtgtttcaa
gacctcgttgatatggctaagaaagctacgttcgctgcttggaagcgtcacgattcgtct
aagccccccatcgtgatcgaagaagaggatatggaggccgccctgaagaattacacgccg
atgtctctgcaagacgtgcaattgtacaaaggcacgggtcacgtttggtcagatattggc
ggcctggccgacgtgaaaagatctctggtagagattttacagtggccgttgaaatatcct
gagatattcaagaatgctcctatcaaactgcaaaatggcattttattatacggcatgccg
ggaacagggaaaactatgcttgccaaagcgattgccaacgaatgcggtgttaatttgatc
agcgttaaaggaccggaattattgtcgaaatacatcggcgttagcgaggagtctgttaga
aacgtattcgagagagctcttcgtgcaaaaccgtgcgtcttgtttttcgacgaattcgac
agtctcgctccgaggcgaggccacgatagcaccggcgtcaccgacagagtggtgaaccaa
ttattaacccaaatggacggagtcgaggatagagaaggtgttgcggttgtggcagcctct
tcaaggccagatttattggatccagccctgttgagacctggacgtctcgacaaagcgttg
tattgtcctcttccggacgaggcggacagaaaggaaattttgaccgctctctgcaaaagg
cagaaagtggacacgacaggattggatttaaaagaactggccacgcttacttcaggcttc
accggcgctgatttgaacgccgtggtgacccaagccaggttatcagccttagagaacgct
attgcgaacgtttccgacggaaagatcgaggcgggggacattaaggtttctcagacacat
ttaatcgattccatcaactccacccatccctctttgcctcgcgccgaaaaggagaagtac
aagaggatttacgcgaaatttgcgaagaacgacaatttcgtggaggatataacgaagaat
cagaaggctactttggcatga

DBGET integrated database retrieval system