KEGG   Apis mellifera (honey bee): 413691
Entry
413691            CDS       T01057                                 
Name
(RefSeq) condensin complex subunit 3
  KO
K06678  condensin complex subunit 3
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ame03036]
    413691
Chromosome and associated proteins [BR:ame03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin I
    413691
SSDB
Motif
Pfam: Cnd3 HEAT_2 UVR
Other DBs
NCBI-GeneID: 413691
NCBI-ProteinID: XP_006564240
BEEBASE: GB42037
UniProt: A0A7M7LNB4
Position
LG5:complement(7068443..7071979)
AA seq 906 aa
MKRKTDNVIKEIFYNVQFNKTCHQSNIKKLTKCYEENNTSDFWDSFISCFRIPLTIPQRH
LRVENTLEFIAKFAASLYSSTNDDESEQSLCPFLIKLFDFVLTNHCAKNPGVRFRICHFL
NMLLNSMGDQAFIDDVLCDKITVSMMDRLLDKSTKVRAQAIFALHRLQDPTDDQCPVIKM
YIFHATKDPKAMVRRAALMSMAKNQRTLQVALRRTRDVDEIVRKMAYDFISKVTVRSLTI
TQRDQLLNDGLKDRSEIVKNTVQNVLLPAWLRHYNGDFIGLIRALDAEIGTDVSVLALDI
LFKNTPLNTLIEQLPIDKETKLIPINKLTSETVLYWKCLIKHLQHESFTEELEEILPELS
TFCNYISDFITTISSRENEMWVNHMQKFILLQLFEISTTYDLCDEVGRKKLNELICNTLM
SNNWTEKLIECIVTHLQKIIPDVNSRLDTLANIISEIRLPLKETTTTQVSEEQQHQINLQ
RAKLKIKMLELKEEEYQAIQDKQYLKADSLKNEIISLTKEIEKLSEQNQVTSIINEEMKE
KSDSKTMIKCLTIICTMMQSVTTITPTLRSLMQIALDSLDHPNDAVHILAIKAVSICCIL
DKELAKQHIMMLFLQFSLEQENPDIWIVALKGIFDLLLLHGLEYFDISEKTNEISLDKTE
KSRTKLFTDTDKEVSLSLGMSEAEKGNYCFIKILAGLLDNENQGLRTIAAEGLCKLLLNR
RISGSSLLSRLIILCYNPVNDNDFYLRQCLTGFFDNFITLVDAQTSLEETYLPTLQILCN
APEISPLHEIDPYEVSRFIINLTRVGIHKSDAENYCVHNNLVFNMLAEVLNPSSKIHSEV
LLKSLSDLHLELDDTLQKNLQQAIKKVTKMVKQDKRLLKYIELFKKKLNTPDICNVSENE
DTEVDE
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgaaacgaaaaacggataatgttataaaagaaatattttacaatgttcaatttaataaa
acttgtcatcaaagtaatattaaaaaattgacaaaatgttatgaagagaataatacatca
gatttttgggattctttcatatcttgctttagaattccacttactattccacagcgacat
ttacgagttgaaaatactttagaatttattgctaaatttgccgctagtttatattcatct
acaaatgatgatgaatctgaacaatctttatgtccttttctcattaagttatttgacttt
gttttaacaaatcattgtgcaaaaaatccaggagtgagatttcgtatttgtcacttttta
aatatgttattaaattctatgggtgatcaagcttttatagatgatgttctttgtgataaa
attactgtttctatgatggatcgtttattggataaatctacaaaagttagagctcaagca
atatttgctttacatagacttcaagatcctacagatgaccaatgtcctgttataaaaatg
tatatatttcatgcaaccaaagatccaaaagctatggttcgtagagcagcattaatgagt
atggcaaaaaatcaacgtactctgcaagtagcattgagaaggactagagatgtggatgag
attgttcgtaaaatggcatatgatttcattagtaaagtaacagtaagatctttgactatc
acacagagagatcagttgctaaatgatggtttaaaagatagatctgaaatagttaaaaac
actgttcaaaatgttttattacctgcatggttaagacattataatggtgactttattggt
ttaataagagcgcttgatgctgaaattggtacagatgtgtctgttttagctttagatatt
ttatttaagaatactccattaaatacattaatagaacaattaccaatagataaagaaacc
aaattaattccaataaataaattgactagtgaaactgtattatattggaaatgcttaata
aagcatttgcaacatgaatcttttacagaagaattggaagaaattttaccagagctatca
acattttgcaactatatttctgatttcattacaacaatatcatcaagagaaaatgaaatg
tgggtaaatcatatgcaaaaatttattctattacaattatttgaaatatcaacaacatat
gatttatgtgatgaagttggtagaaaaaaattgaatgagttaatttgtaatacattaatg
agcaataattggacagaaaaattaattgaatgcatagtaacacacttacaaaaaattata
cctgatgtgaatagtagattggatactttagctaacataatcagtgaaattagattacct
ttaaaagaaactacaactacacaagtttcagaagaacaacaacatcaaattaacttacag
agagcaaagcttaaaataaagatgttggaattgaaagaagaagaatatcaagctatacaa
gacaaacaatatttgaaagcagatagcttaaaaaatgaaataatctcattgactaaggaa
atagaaaaattatcagaacaaaatcaagtaacaagtataattaatgaagaaatgaaagaa
aaaagtgattctaaaacaatgataaaatgtttaacaataatatgtacaatgatgcaatct
gtaactacaataacaccaacacttagaagtcttatgcaaatagcacttgacagtttagat
catccaaatgatgcagtacatatattggcaataaaagcagtctctatttgttgtatattg
gataaagaattagctaaacaacatattatgatgttatttttacaattttctttggaacaa
gaaaatccagatatttggattgttgctttgaaaggaattttcgatctcttactgttgcat
ggtcttgaatattttgatatttcagaaaaaacaaatgagatctcacttgataaaactgaa
aaatctcgcactaaattatttacagatactgataaagaagtttctttatcattaggcatg
tcagaagcagaaaaaggcaattactgttttattaaaatcttagcaggattattagataat
gaaaatcaaggattaaggacaattgctgctgaaggtctttgtaaattgttacttaatcga
cgaatcagtggttcaagtttattatcacgattaataattttatgttataatcctgtaaat
gataatgatttttatctccgacaatgtttgacgggttttttcgataattttatcacactc
gttgatgcccaaacatcattagaagaaacatatttaccaaccttacagattttatgtaat
gcgccagagattagtcctttacatgaaattgatccttatgaagtatctaggtttataata
aatttgactagagttggaattcataaatctgatgcagaaaattattgtgtgcacaataat
cttgtttttaatatgctcgcagaagtgttaaatccatccagcaaaattcattctgaagtt
cttcttaaatctttaagtgatttgcatttagaattagatgatacattgcaaaaaaattta
caacaagccattaagaaagtaacaaaaatggtaaaacaggataagcgattattaaaatat
attgaactttttaagaaaaaattaaatactcctgatatttgtaatgtatcagagaatgaa
gatactgaagttgatgaatga

DBGET integrated database retrieval system