KEGG   Apis mellifera (honey bee): 413772
Entry
413772            CDS       T01057                                 
Name
(RefSeq) myosin-G heavy chain
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ame04121]
    413772
Ubiquitin system [BR:ame04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul5 complex
    Target recognizing subunit
     413772
SSDB
Motif
Pfam: SH2 SOCS_box WAC_Acf1_DNA_bd
Other DBs
NCBI-GeneID: 413772
NCBI-ProteinID: XP_006572407
BEEBASE: GB52510
UniProt: A0A7M7H6S3 A0A8B6ZC88
Position
LG11:complement(4267918..4271773)
AA seq 825 aa
MDSPSSCSLSATGPLSDLGSSGIGGSISSDSVRAHLAIEMQESDIESKSLSQDSFDYSDG
MCGENFNTLKKGPGWTDADGKLEVEVVDVAIKPPPEFQDSPSPPNSESSSAPILSYAQLM
RQKVPQLIDDYAENLVQSMIEEALIISCRISWPEGRIAPATNHVPVVTRNIYNPKRLWAT
DLLTPSCQGATTLITPYNTLNRPNSRCSLASSRLSSSHNSINTSGLSHKADDSSFITSAM
SHDVLTTSEISDMYNVPFDSDIYTVPIDVVRPLHDLRTPQRPKRHRHHRKRRRNVSASSQ
SELEAHIQQARHYCGKPRAITHVIKSQRLLSDVCCNETGNGKRHSVPGTSGRHMSRTSNG
HMHNIGEPIHMTLHEVRQYLQTLYSSSSDSSENKIKRDNKAPISHTPVHLAMPKGISVNN
NNRYSNPHTDSTMDTPISNKNSNGLIHNNNNNNNNNNNNNSNVKKHKKNSFVSIKHKKVK
EESHKEKVDSEREKIKKSQRNFSLNLKQTLCNIFRFRRLGSPDHFVEKRNSIVQGEIVEE
EESIDSDQHANNNNTTSEVDSSVQKLPFFKRALPPLPKSNGHVGGVEQAEDALTTMVSKC
ESPTSIPSQIPLPVPKVEDEPAEDTSMDFAASIEKVKDYGWYWGPISGEAAEKILSNEPD
GSFIVRDSSDDHYIFSLSFRLNSCVRHVRIEHDQGNFSFGSCTKFKSHTIVDFIENAVEH
SRSGRYLFFLHRRPVLGPMRVQLLHPVSRFKQVQSLQHTCRFVILKMVRRDLIPTLPLPR
RLIDYLSTPHYYSEQLAEQDDRAESPVSSSTGELEKICFTPQGLS
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggactctccatcgtcttgttcactaagcgctactggacctcttagtgatcttggtagc
agtggaattggagggtccatttctagtgattcagttagagctcatcttgcaatcgagatg
caagaaagcgatatagaaagtaaatctttatcgcaagattcgtttgattattcagatggt
atgtgtggtgaaaattttaatacattgaaaaaaggaccaggatggactgatgctgatgga
aaactggaagttgaagtggttgatgtagctattaaacctccaccagaatttcaagatagc
ccttctcctcctaattctgaatcttcatctgcaccgattcttagctacgcacaattaatg
agacaaaaagttccacaattaatagatgattatgctgaaaatttagtacaatcaatgatt
gaagaagcactaataatatcttgtagaatatcatggccagaaggaagaatagcacctgca
acaaatcatgtaccagtggtaactcgtaatatatataatccaaaacgtctttgggcaaca
gatttgttgacaccatcatgccaaggagctactactttaattactccatataatacttta
aatcgtccaaattcacgatgttcattagcatcttctcgtttatccagttctcataattca
ataaatacctcaggactgagtcataaagcggatgacagcagttttatcacctctgctatg
tcacatgatgttttaacgaccagtgagattagtgatatgtacaatgtgccctttgattct
gacatttatactgtaccaatagatgtagttagacctttgcatgatcttagaacaccgcaa
aggcctaaacgtcatagacatcatcgtaaaagaagaagaaacgtatctgctagttcacaa
agtgaattagaagcccatattcaacaagcaaggcattattgtggaaaacctcgtgctatt
acccatgttattaaatcacagagacttttatctgatgtatgctgtaatgaaactggaaat
ggaaagcgtcatagcgttccgggtacatctggtcgacatatgtctcgaacatctaatggt
cacatgcataatattggtgaaccaattcatatgactttacatgaagtgcgtcaatatttg
caaacattatattcaagctccagtgattctagtgaaaataaaattaaacgcgataataaa
gctccaataagtcatacacctgtgcatcttgcaatgccaaaaggtattagtgtaaataat
aacaatagatatagtaatccacatacagattcaacaatggatactcctatttcaaacaaa
aatagcaatggactgattcacaataataataataataacaacaataacaataataataat
agtaatgttaagaagcataaaaaaaattcatttgttagtattaaacacaaaaaagtaaaa
gaggaatcacataaagaaaaagttgattctgaaagagaaaagattaaaaagagtcagcga
aacttttcattaaatttgaaacaaacactttgcaatatctttagattcaggcgtttgggt
tctccggaccatttcgtagaaaagagaaatagcattgtacagggcgaaattgtagaagaa
gaagaaagcattgattctgaccaacatgctaataataataatactacctcagaggtagat
tcctctgtacaaaagctacctttttttaaacgtgcattaccaccattgcctaaaagcaat
ggacatgtaggaggtgtggaacaagcagaagatgcacttacaacaatggtgtctaaatgt
gaaagtccaacttcgataccatcacaaatacctctacctgtaccaaaagttgaggatgaa
ccagcagaagatactagtatggattttgctgctagtattgagaaagtaaaagattatgga
tggtattggggcccaatatctggtgaagctgcagagaaaatactgtccaatgaaccagat
gggtcattcattgtacgagatagtagtgatgatcattatattttttccttatcatttaga
cttaacagttgtgtacgacatgtaagaatagagcacgatcagggtaattttagctttgga
agttgcacaaaatttaaatctcatacaattgttgattttattgaaaatgcggtagaacat
tcgcgtagtggacgatatttgttttttcttcatcgacggccagtgttaggtccaatgcgt
gtgcaacttcttcatccagtgtcaagatttaaacaagttcaaagtttacagcatacgtgc
agatttgtaattttgaagatggtacgcagggatcttattcccactctacctctgcctcgg
cggctcattgattatctgagcacgcctcattattacagtgagcaattagctgaacaagat
gatagagctgaatctcctgttagttcttcaactggtgaattagagaagatttgtttcaca
ccacaaggcctatcgtga

DBGET integrated database retrieval system