KEGG   Apis mellifera (honey bee): 413809
Entry
413809            CDS       T01057                                 

Name
(RefSeq) mitogen-activated protein kinase kinase kinase 7 isoform X2
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04013  MAPK signaling pathway - fly
ame04140  Autophagy - animal
ame04214  Apoptosis - fly
ame04310  Wnt signaling pathway
ame04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    413809
   04310 Wnt signaling pathway
    413809
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    413809
  09143 Cell growth and death
   04214 Apoptosis - fly
    413809
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    413809
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ame01001]
    413809
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     413809
Protein kinases [BR:ame01001]
 Serine/threonine kinases: TKL group
  MLK family
   413809
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 413809
NCBI-ProteinID: XP_006572357
BEEBASE: GB48187
UniProt: A0A7M7H1G9
AA seq 530 aa
MADKELVSHQQQFVEEINYDEIETEQVVGKGSFGVVWKGRWKGQYVAIKYINSEGEKKAF
TIEVRQLSRVIHPNIVKLYGACTKNPVCLVMEYAEGGSLYNVLHCNPQPQYTAGHAMSWA
LQCARGVAYLHNMKPKPLIHRDLKPPNLLLVMGGQTLKICDFGTACDLNTYMTNNKGSAA
WMAPEVFEGSKYTEKCDVFSWGVILWEILSRKKPFDEIGGSAYRIMWAVHIGQRPPLIED
CPKPLEDLMIRCWHKSPEERPSMDEVVEIMTTLSQFFNEHLEPVEYSRNVTDSMDSEING
YAANGTIKINVPASKENSEILNGRNSSSNSFCDFKNSSSKNNISSSIVSNKKFQIKDFPQ
LYVECDPNAWELPNSDPSLESSILKIKNTTQSNSTTDKDLDNVYRLLDADLRPLTPDQTC
ERSKEIFEEHKQLAQEYLKVQTEIALLGQHKNEMLKNLTIDSLRQQEELRKLEDEKESLI
KLYRNLKRQLEIMKNQRINNVLLSNAQVDPTVSGNNGWFVVPCQNPPRHS
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggcggataaagagttagtaagccatcagcagcagtttgtagaagaaattaattatgat
gagattgaaaccgagcaggtagtgggaaaaggttcttttggagtagtatggaaaggaaga
tggaaaggtcaatatgttgctataaaatatataaattcagaaggtgaaaaaaaagccttt
actatagaagttagacaattatctagagttatacatcccaatattgtaaaactttacggt
gcatgtacaaaaaatccagtttgtctagttatggaatatgcagaaggcggctctttatat
aatgttttacattgtaatcctcagccacaatatactgcaggtcatgcaatgagttgggct
ttgcagtgtgcacgtggtgttgcatatcttcacaatatgaaaccgaaacctttaattcat
agagacttaaaaccaccaaatctgttgttagtaatgggtggacaaactcttaaaatttgt
gattttggtactgcttgtgatttaaatacttatatgactaacaacaaaggttctgctgct
tggatggctccagaagtatttgagggttccaaatacacagaaaagtgtgatgtatttagt
tggggtgttattttgtgggaaatattatcaaggaaaaaaccatttgatgaaattggtggt
tcagcttatagaataatgtgggcagtacatataggacaaagacctcctttaattgaagat
tgtccaaaacctcttgaagatcttatgattagatgttggcataaatctcctgaagaaaga
ccatcaatggacgaagttgtagaaataatgacgactttatcgcaattttttaatgaacat
ttggaacctgtggaatattcccgaaatgtaactgatagtatggattctgaaataaatgga
tatgctgccaatggtactattaaaattaatgtacctgcttccaaagaaaattcagaaatt
ttaaatggaagaaatagttcatcgaattccttttgcgatttcaagaattcatcttctaaa
aataatatttcatcaagtattgtatccaacaaaaaattccaaatcaaagattttccacaa
ctttatgttgaatgcgatccgaatgcttgggaattgccaaattcggacccttcattggaa
tcttctattctgaaaataaagaatactactcaaagtaatagtactactgacaaagattta
gataatgtttatcgacttttggatgcggatttgagaccattgacacctgatcaaacttgc
gaaagatcaaaagaaatttttgaagaacacaaacaacttgcgcaagaatatttgaaagtt
caaacggaaatagcgctcttgggtcaacataaaaatgaaatgcttaaaaatttgacgata
gatagtttaagacaacaagaagaacttagaaaactagaagatgaaaaagaatctttaata
aagctatatcgaaatttgaaacgacagttagaaatcatgaaaaatcagagaataaacaat
gttcttttgagcaatgctcaagtggatccaacagtttctggaaacaatggctggtttgtg
gtaccttgtcaaaatcctccaagacactcttga

DBGET integrated database retrieval system