KEGG   Apis mellifera (honey bee): 413875
Entry
413875            CDS       T01057                                 
Name
(RefSeq) 60S ribosomal protein L31
  KO
K02910  large subunit ribosomal protein L31e
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    413875
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ame03011]
    413875
Ribosome [BR:ame03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    413875
  Archaea
    413875
SSDB
Motif
Pfam: Ribosomal_L31e Vsr
Other DBs
NCBI-GeneID: 413875
NCBI-ProteinID: XP_003251167
BEEBASE: GB54814
UniProt: A0A7M7GB39
Position
LG8:9476484..9477555
AA seq 123 aa
MAKSKEKKGKSAMSEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDVRI
DTRLNKQLWSKGIRNVPFRVRVRLSRRRNDDEDSANKLYTLVTYIPVASFKGLQTENVDA
SQD
NT seq 372 nt   +upstreamnt  +downstreamnt
atggctaaatccaaggaaaaaaaaggtaaaagtgctatgagcgaggttgtgactcgtgaa
tatacagtgaatctccacaaacgtctccatggtgttggatttaaaaagcgtgctccacga
gctattaaagaaattcgcaaattcgctgaaaaacaaatgggaactccagatgtgagaatt
gatacacgactcaataaacaactttggtctaaaggaattaggaatgtaccatttagagtt
cgtgtacgattaagcagaagaagaaatgatgatgaagattctgcaaacaaattatatacc
cttgttacttatataccagttgcttcctttaagggtttacaaacagaaaatgttgatgcc
agtcaagattga

DBGET integrated database retrieval system