KEGG   Apis mellifera (honey bee): 414039
Entry
414039            CDS       T01057                                 

Name
(RefSeq) probable small nuclear ribonucleoprotein Sm D2
  KO
K11096  small nuclear ribonucleoprotein D2
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    414039
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ame03041]
    414039
   03032 DNA replication proteins [BR:ame03032]
    414039
Spliceosome [BR:ame03041]
 Complex A
  U1 snRNP components
   Sm proteins
    414039
  U2 snRNP components
    414039
 Complex B
  U1 snRNP components
    414039
  U4/U6.U5 tri-snRNP components
    414039
 Complex C
  U2 snRNP components
    414039
DNA replication proteins [BR:ame03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     414039
SSDB
Motif
Pfam: LSM Hfq
Other DBs
NCBI-GeneID: 414039
NCBI-ProteinID: XP_397475
BEEBASE: GB10555
UniProt: A0A7M7RA10
Position
LG1:18546487..18547386
AA seq 120 aa
MSSLTKPKSEMTPEELAKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFD
RHCNMVLENVKEMWTELPRTGKGKKKAKPVNKDRFISKMFLRGDSVILVLRNPLATASGK
NT seq 363 nt   +upstreamnt  +downstreamnt
atgtcttctttaactaaaccaaaatctgaaatgactcctgaggaattagcaaaaagagaa
gaagaagaatttaatactggaccactctcagtattaacacaatctgtaaaaaataataca
caagtcttaattaattgtagaaataataaaaaattattaggaagagtaaaagcatttgat
aggcattgcaatatggttttagaaaatgtaaaagaaatgtggactgaacttccacgtact
ggaaaagggaaaaaaaaggcaaaaccagtaaacaaggatagatttatttctaagatgttc
ctaagaggtgattctgtaattttagttctacggaatccattagcaacagcatcaggaaaa
taa

DBGET integrated database retrieval system