KEGG   Apis mellifera (honey bee): 550692
Entry
550692            CDS       T01057                                 
Name
(RefSeq) TATA-box-binding protein
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    550692
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ame03000]
    550692
   03021 Transcription machinery [BR:ame03021]
    550692
Transcription factors [BR:ame03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    550692
Transcription machinery [BR:ame03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     550692
  RNA polymerase III system
    TFIIIB
     550692
  RNA polymerase I system
    SL1/TIF-1B
     550692
SSDB
Motif
Pfam: TBP DUF2722
Other DBs
NCBI-GeneID: 550692
NCBI-ProteinID: XP_623088
BEEBASE: GB47180
UniProt: A0A7M7TFK3
Position
LG9:1638156..1639775
AA seq 321 aa
MDQMLPSPGFSIPSIGTPLHQPEEDQQILPNALQQQQQQQQQQQQQQSQQQQQSQQQYQL
QQLHTMSPNIQSGMLMIGTPQKNMHAYATTPTFATPQSLMQPQTPQNMMSPLVQNTNHIA
PPSIGPSTPGPMTPMTPASADPGILPQLQNIVSTVNLNCKLDLKKIALHARNAEYNPKRF
AAVIMRIREPRTTALIFSSGKMVCTGAKSEEDSRLAARKYARIIQKLGFPAKFLDFKIQN
MVGSCDVKFPIRLEGLVLTHGQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKV
RQEIYEAFDNIYPILKSFKKQ
NT seq 966 nt   +upstreamnt  +downstreamnt
atggatcaaatgttacctagtcctggatttagtattccaagtataggtacacctttacat
caaccagaagaggatcaacaaatcttacctaatgcgttacaacagcagcaacaacagcaa
cagcaacagcaacaacaacaatcacagcagcagcaacaatcacaacaacaatatcaatta
caacaactacataccatgagtccaaacatacaaagtggtatgctaatgatcggaacacca
caaaaaaatatgcatgcctatgcaacaacacctacttttgcaacaccacagagtcttatg
caacctcaaacaccgcaaaatatgatgtctccgttagtacaaaatactaatcatatagct
cctccatctataggaccatctacacctggtcctatgacacctatgacaccggcttctgca
gatccaggaatattacctcaacttcagaatattgtttctacagttaatttaaattgcaaa
ttagatttaaaaaaaatagctcttcatgctagaaatgcggaatataatccaaagagattt
gctgcagttattatgaggataagagaaccaagaactactgcattgatatttagtagtgga
aaaatggtttgtactggagcaaagagtgaagaagattctcgattggcagcaagaaagtat
gctagaattattcagaaacttggttttcctgcaaaatttcttgatttcaaaatacaaaat
atggtaggcagctgtgatgtgaaatttccaattagattagaaggtttagtacttacacat
ggacaattctcctcatatgaacctgaactttttcctggattaatatatcgtatggttaaa
cctagaatcgttttacttatatttgtttcaggaaaagtagtgttaacaggagcaaaagtt
agacaagagatttatgaggcatttgataatatctaccctattttgaagagctttaaaaag
cagtga

DBGET integrated database retrieval system