KEGG   Apis mellifera (honey bee): 550701Help
Entry
550701            CDS       T01057                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP8 isoform X2
  KO
K09574  FK506-binding protein 8 [EC:5.2.1.8]
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ame01009]
    550701
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ame03110]
    550701
Enzymes [BR:ame01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     550701
Protein phosphatases and associated proteins [BR:ame01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     550701
Chaperones and folding catalysts [BR:ame03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    550701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_8 TPR_11 Fis1_TPR_C TPR_16 FKBP_N_2 TPR_10 DUF4164 TPR_17 TPR_9 CM_2
Motif
Other DBs
NCBI-GeneID: 550701
NCBI-ProteinID: XP_006557515
BEEBASE: GB46606
AA seq 372 aa AA seqDB search
MEDESNQSGTTQADFINEELNFDIDPNEPMTKATLNEHPPEEWIDILGNGQLKKKVIKNG
KNGTRPNRSDICTLKIIGKLKDNTIVEKYEDLKIQLGDVELIQGLDLAIALMDVNEIAEI
EVDPRFAYGSLGKEPNIPSNATILYTVELKSSELEAEIETLNANQRKEIGNKKRERGNWW
FTRNEPTLAIQCYRRALEFLLPTESRTPYQSEAEDTTDAELQALLEDRMKVYNNLAAAQM
KTQAYDAALKSVESVLSCQPQNVKALFRKGKILHYKGEHALAYQTLLQAAKLEPETKAIQ
MELAILKEKNAKDAQHEKNLYRKMLGAHKNNNTSLKNLKKGNKNKNSSKFTWSLIGGATA
AVLSVLLYRFIS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgaatctaatcagtcaggaacaactcaagctgatttcattaatgaagaatta
aactttgatatagatccaaatgaaccaatgacaaaagcaactttaaatgaacatccaccc
gaagagtggatagatattttaggaaatggacagcttaaaaaaaaagttataaaaaatgga
aaaaatggaacacgaccaaatagatctgatatttgtactttaaaaattattggcaaatta
aaagataatacaatagttgaaaagtatgaagatcttaaaattcaattaggagatgttgaa
ttgattcagggattagatttagcaattgcattaatggatgtgaatgaaattgctgaaatt
gaagttgatccaagatttgcttatggttctctaggaaaagaaccaaatattccatctaat
gcaactattttatatacagttgaattaaaatcaagtgaattagaagcagaaatagaaaca
cttaatgctaatcagcggaaagaaattggcaataaaaaacgagaacgtgggaattggtgg
tttactcgtaatgaaccaacacttgcaattcaatgttaccggagagcattagaatttttg
ttaccaacagaaagtcgtacaccctatcaaagtgaagcagaagatactactgatgcagaa
ttgcaagctttgttagaggatcgtatgaaagtatataataatttagcagctgcacaaatg
aaaacacaagcttatgatgcagcattgaaaagtgtagaaagtgttttgagttgtcaacct
caaaatgtaaaagctctatttagaaaaggaaaaattttgcattataaaggagaacatgca
ttagcatatcaaacattgcttcaagcagcaaaattggagccagaaacaaaagctattcag
atggaattagctattttaaaagaaaaaaatgctaaggatgctcagcatgaaaagaattta
tatcgtaaaatgttaggtgcacataaaaataacaatacatctttaaaaaatttaaagaaa
ggaaataagaataaaaattcatcaaaatttacatggagcttaattggtggagcaactgct
gcagttttaagtgtccttttatacagatttatttcgtga

DBGET integrated database retrieval system