KEGG   Apis mellifera (honey bee): 550785Help
Entry
550785            CDS       T01057                                 

Definition
(RefSeq) fructose-bisphosphate aldolase
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00010  Glycolysis / Gluconeogenesis
ame00030  Pentose phosphate pathway
ame00051  Fructose and mannose metabolism
ame01100  Metabolic pathways
ame01200  Carbon metabolism
ame01230  Biosynthesis of amino acids
Module
ame_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ame_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    550785
   00030 Pentose phosphate pathway
    550785
   00051 Fructose and mannose metabolism
    550785
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ame04131]
    550785
   03036 Chromosome and associated proteins [BR:ame03036]
    550785
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ame04147]
    550785
Enzymes [BR:ame01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     550785
Membrane trafficking [BR:ame04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    550785
Chromosome and associated proteins [BR:ame03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    550785
Exosome [BR:ame04147]
 Exosomal proteins
  Proteins found in most exosomes
   550785
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 550785
NCBI-ProteinID: XP_006563323
BEEBASE: GB40735
AA seq 365 aa AA seqDB search
MAAEKYDKLTPELKQELKSIAQQIVAPGKGILAADESTATIGKRLKDINVENTEDNRRAY
RQLLFTSAKDAISQHISGVILFHETLYQKADDGTPFVELLKQRNILPGIKVDTGVVTLFG
TEEETTTQGLDNLQARCIQYKKDGCQFAKWRCVLKIRKDCPSKLAILENANVLARYASIC
QSARIVPIVEPEILPDGDHDLARCQQVTEEVLAAVYKALSDHHVYLEGTLLKPNMVTPGQ
SCPNKASPQEIAAATVTALLRTVPPAVPGITFLSGGQSEEEASVNLDAINKFPANKPWAL
TFSYGRALQASVLRAWGGKKEQISAGQEELIKRAKANSESALGKYSGGVVGAAGNATLFV
ANHAY
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagaaaaatatgataaactcactcctgagttgaaacaagaattgaagagcatc
gcccagcaaattgttgcgcccggaaaaggaatcctcgctgcggatgaatcgaccgcaacg
atcggcaagcgtctaaaagacatcaatgttgaaaatactgaggacaatcgcagagcatac
agacaacttctttttaccagcgctaaagatgccatcagccagcatatatctggtgttatt
ctattccacgagaccttgtaccagaaggctgatgatggaacaccattcgtcgaattgctg
aaacaacgtaatatcttgccaggtatcaaggttgacacaggtgtagtaacattatttggt
accgaggaagaaaccactacgcagggtctcgacaatcttcaagctcgttgtattcaatac
aagaaagatggatgtcaattcgccaaatggagatgcgtgctgaaaatcagaaaagattgt
cccagcaaattggccattttggaaaatgccaatgttttggctcgttacgcttctatttgt
caaagtgctagaattgtgccaatcgtcgagcctgagattttacctgatggtgatcatgat
cttgcccgttgccaacaggtcacggaagaagtattggccgccgtgtacaaggcactcagt
gaccatcatgtgtatcttgagggaactcttttgaaaccgaacatggtaacaccaggacag
agttgcccaaataaagcgtcacctcaggaaatcgcagcagctactgtgaccgctttattg
cgtactgttccacctgcagtacctggaattactttcctcagcggcggtcaatcagaagag
gaggcgtctgtgaatctggatgctattaacaagttccccgcgaacaaaccttgggctttg
accttcagctatggtcgtgctcttcaagcttccgtgcttcgcgcatggggaggcaagaag
gaacagattagcgctggccaggaagagcttatcaagagggctaaggctaacagcgaatcg
gcactcggcaaatacagcggtggtgtagtgggagctgctggcaatgctacgcttttcgtc
gcgaatcacgcgtactaa

DBGET integrated database retrieval system