KEGG   Apis mellifera (honey bee): 550827
Entry
550827            CDS       T01057                                 

Definition
(RefSeq) tubulin alpha-1 chain
  KO
K07374  tubulin alpha
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    550827
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ame03019]
    550827
   03036 Chromosome and associated proteins [BR:ame03036]
    550827
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ame04812]
    550827
   04147 Exosome [BR:ame04147]
    550827
Messenger RNA biogenesis [BR:ame03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     550827
Chromosome and associated proteins [BR:ame03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     550827
Cytoskeleton proteins [BR:ame04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    550827
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   550827
  Exosomal proteins of other body fluids (saliva and urine)
   550827
  Exosomal proteins of colorectal cancer cells
   550827
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Other DBs
NCBI-GeneID: 550827
NCBI-ProteinID: XP_623220
BEEBASE: GB46039
UniProt: A0A088A436
AA seq 450 aa
MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFIDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLD
RIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVSEITNACFEPAN
QMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGMDSAEGEGEGAEEY
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgcgtgaatgtatctcagttcatgttggacaagccggtgtccaaattggtaatgcgtgt
tgggaattatattgtctagaacatggcatccaacctgatggacaaatgccatctgacaaa
actattggtgggggagatgatagtttcaatacgttttttagtgaaactggtgcaggaaaa
catgtacctagagcagttttcattgatttggaacccacagtagttgatgaagtacgtact
ggtacttatcgtcagctatttcatccagaacaattgattactggtaaagaagatgcagct
aacaactatgcccgtggccattatacaattgggaaagaaattgtagatcttgtattagat
agaatacgtaaattggctgatcaatgtactggtcttcaaggtttcctcatcttccattct
tttggaggtggtactggttctggtttcacttctcttttgatggaacgtctttctgtagac
tatggcaagaaatcaaagttggaatttgctatttatcctgctccacaagtttctactgca
gttgttgaaccatataattcaattctcaccacacataccactcttgaacattccgattgc
gcatttatggttgacaatgaagccatttacgatatttgtcgtcgtaatttagacatcgaa
agacctacctatactaatttaaatcgactaattggccaaattgtatcctctattacagct
tctttgcgatttgacggtgcattgaacgttgatttgactgaattccagacaaacttagta
ccttatcccagaattcatttccccttggtaacttatgcacctgttatttctgcagagaag
gcatatcatgaacaactctctgtatcagagattacgaatgcgtgttttgaaccagcaaac
caaatggtgaaatgtgatcctcgccatggaaaatacatggcctgctgtatgttgtataga
ggtgatgttgtacccaaagatgtaaatgcagcaattgccaccataaaaacaaaacgtact
attcaatttgttgattggtgcccaactggatttaaagttggtattaattatcagcctcca
actgtggtacctggtggtgatcttgctaaagtacaacgtgctgtttgtatgttgtcaaac
acaaccgctattgcggaagcttgggctcgtcttgatcataagttcgatttgatgtatgcc
aaacgtgcatttgtccattggtacgttggtgaaggtatggaagaaggtgaattttccgaa
gcacgtgaagatctagcagctcttgaaaaagattatgaagaagtcggtatggattccgct
gaaggtgaaggagaaggtgccgaagaatactaa

DBGET integrated database retrieval system