KEGG   Apis mellifera (honey bee): 551069
Entry
551069            CDS       T01057                                 

Definition
(RefSeq) diacylglycerol kinase 1 isoform X2
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00561  Glycerolipid metabolism
ame00564  Glycerophospholipid metabolism
ame01100  Metabolic pathways
ame04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    551069
   00564 Glycerophospholipid metabolism
    551069
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    551069
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     551069
SSDB
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Other DBs
NCBI-GeneID: 551069
NCBI-ProteinID: XP_006571176
BEEBASE: GB40016
AA seq 905 aa
MAFHWDKLSPAEFQQLQDLAAYSTRKLQDVLTEFCGSNTTPSGAPKYHPDGDIDYEGFRK
FLDTYLEVTTPDELSRHLFLSFVKKVPRGVDGKAFKEMAVLSSTTACAAITSHTTSSSNV
NSTGLPGGTSSEGGHGSSLADKIHGLTEKLQALGHHRTDSEVSTRARTGSVHPILTIQQH
TSYSCHDVIEKKSTDSSPSHSQMSRNSSRKSNNSLLINNGKLEEMRHLVRKQSTIDVHSV
KVSLKDIVCYLSLLEAGRPEDKLEFMFRLYDTDGNGVLDTNEMDCIVNQMMNVAEYLGWD
VTELKPILQDMMIEIDYDADGTVSLEEWKRGGLTTIPLLVLLGLDSHVKEDGNHLWRLKH
FSKPAYCNLCLNMLVGLGKKGLCCVFCKYTVHERCVQRAPASCIATYVKSKKTSQTMAHH
WVEGNCHGKCFKCKKTIKSYNGITGLHCRWCQITLHNRCVSQIRAECTLGEYAVHILPPT
AICPVVLDRQRSLSRDSKRGSKHGQDSSTVSTSGFLTSGTATNQQPAMSFQITPPSGIVP
LLVFINPKSGGRQGERMLRKFQYILNPRQVHNLAMGGPMQGLQMFKDVENFKVICCGGDG
TVGWVLETMDRVQFEHQPAVGVIPLGTGNDLARCLRWGGGYEGEAIHKVLKKIEKATPVM
MDRWQIEVLDQKDEKKPNQDSIPYNIINNYFSVGVDAAICVKFHMEREKNPEKFNSRMKN
KLWYFEYATTEQFAASCKNLHEDLEIICDGTPLDLAHGPSLQGVALLNIPFTHGGSNLWG
EHHTRHRRLGKRKKRPDKELSTSSFNSVDLTAAIQDIGDNLIEVIGLENCLHMGQVKTGL
RHSGRRLAQCSSVTITTSKRFPMQIDGEPWMQGPCTIHITHKNQVPMLMAPPPEKGRGFF
RFLKR
NT seq 2718 nt   +upstreamnt  +downstreamnt
atggcctttcattgggataagctctcgccagcggaatttcaacaactccaggatttagca
gcttattccacacgaaagctacaggatgtcctcactgagttttgcggatcaaatacaaca
ccaagcggtgcgcccaaatatcatccagatggtgacattgattacgagggatttcgtaaa
tttctggacacctatctcgaagtgacaacccctgacgaactttcacgacatctttttttg
tcgttcgttaaaaaggtgccacgaggagtcgatgggaaagcttttaaggaaatggccgtg
ctctcgtcgacaaccgcttgtgccgccattacgtctcacacaacgtccagcagcaacgtg
aacagcacaggtctacctggtggaacatcgtcggagggtggacacggttcctctttggct
gacaaaattcacggtctcacagagaaattgcaggcgttgggacatcatagaacggacagt
gaagtctccaccagagcacgcacaggaagcgttcatcccatattgacgatacaacagcac
acgtcgtacagttgccatgacgtgatagagaaaaagagcacggacagcagcccgagccat
agccaaatgtcgcggaattcgtccaggaagtcgaacaattccctcctcatcaacaacggg
aaattagaagaaatgagacatctcgttagaaagcaaagcacgatagacgtccactcggtt
aaagtcagtcttaaggatatcgtgtgctatctttctcttctggaggctggcagaccagaa
gataaattggagtttatgttccggctatatgatacggatggaaacggcgttcttgatacc
aatgaaatggactgcattgtcaatcaaatgatgaatgtcgccgagtatctcggatgggat
gtcacggaattgaaaccgatactgcaagacatgatgatagaaatagattatgatgcggat
ggtacagtgtctttagaagagtggaaaagaggtggtcttacaacgatacccttactggtt
cttttgggcttggattctcacgtaaaggaagatggtaatcatctctggaggctaaaacac
tttagcaaacccgcctattgtaatctctgtttaaatatgttagttggtctcgggaagaag
ggtctttgctgtgttttttgcaaatacacggtccatgaaagatgtgttcaaagagcgcca
gcttcttgtattgccacctacgttaaaagtaaaaaaacatctcagacaatggcgcatcat
tgggtcgaaggaaattgtcacggaaaatgcttcaaatgtaaaaaaactatcaaaagttat
aatggaatcacgggtttacactgtagatggtgtcaaataacattacataacagatgtgtc
tcgcaaataagggcggaatgtacacttggtgaatatgcagttcatatccttcctcctaca
gcgatttgtccagttgttctggacaggcaaagatcgttatcaagagatagtaaaagagga
agtaaacatggacaagattcatcaactgttagtacaagtgggtttctaacatctggaaca
gctactaatcaacaaccagcaatgtctttccaaattacaccaccatcggggatcgtgcca
cttttagtatttataaatccaaaatctggaggaaggcaaggcgaacgtatgttgagaaag
ttccaatacatcttgaatccgcgccaagttcataatttggccatgggtggacctatgcaa
ggtttacaaatgttcaaagacgtagaaaactttaaggtgatctgctgcggcggtgatggt
accgttggctgggtcttagaaacaatggatcgtgttcaattcgaacatcaacccgctgta
ggtgttataccattgggtacaggcaatgatcttgcaagatgtttacgatggggtggtggt
tatgaaggagaagctattcacaaagttctcaaaaaaatagagaaagcaacgcctgtaatg
atggatcgctggcaaatagaagtacttgatcaaaaagatgagaaaaaaccaaatcaagat
agtataccgtataatatcattaacaattatttctcggtgggtgtggacgcagcgatctgt
gtaaaatttcatatggaaagggagaaaaatcccgaaaaattcaatagtagaatgaaaaat
aaactttggtattttgaatacgcaaccacagaacaatttgctgccagctgtaaaaatctt
catgaagacctcgaaatcatttgtgatggaactccgttggatttagcacatggaccttct
ctccaaggtgtcgcattattaaacattccttttactcacggaggttctaatctctggggt
gaacatcatacaagacatcgtcgtcttggcaaacggaaaaaacgaccagataaagaactc
agtactagcagttttaattccgtagatcttacagccgcaatacaagatattggtgacaat
ctcatagaagtaatcggtttagaaaactgtttgcacatgggtcaagtgaaaactggactt
cgtcattccggtagaagattggctcagtgtagtagcgtcactattactactagcaaacgt
tttccaatgcaaatcgatggtgaaccatggatgcagggtccatgtactattcatataaca
cataagaaccaagtaccaatgttaatggcaccaccaccagagaagggacgaggctttttc
cggtttttaaagaggtga

DBGET integrated database retrieval system