KEGG   Apis mellifera (honey bee): 551167
Entry
551167            CDS       T01057                                 

Definition
(RefSeq) multidrug resistance protein homolog 49 isoform X1
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ame00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    551167
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ame02000]
    551167
   04147 Exosome [BR:ame04147]
    551167
   04090 CD molecules [BR:ame04090]
    551167
Enzymes [BR:ame01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     551167
Transporters [BR:ame02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    551167
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   551167
CD molecules [BR:ame04090]
 Proteins
  551167
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_22 ABC_ATPase AAA_16 RsgA_GTPase AAA_29 AAA_30 G-alpha AAA AAA_7 Zeta_toxin Rad17 AAA_5 ATP-synt_ab Mg_chelatase
Other DBs
NCBI-GeneID: 551167
NCBI-ProteinID: XP_006569044
BEEBASE: GB55378
UniProt: A0A088AUI4
AA seq 1343 aa
MTRRICQWTANPREKAQGMEMEPQKTNSHRQEKIFLKYTLQDAEKDKEETEYMLQENGKP
IEFVPPQTKEEEKSPSEPSLPPVPYFKLFRFATCGELMLIFGGLIMGTLTGLCIPISTIQ
YGEFTTLLVDRNMKNHTSTPTLIMKWFGGGKVLGSNSTYKERMEALYDDSVAFGVSSAAL
STFQFVFAVFTVDLLNVAASRQIVRVRKMFLRSVLRQDMTWYDINTSTNFASRITEDLDK
MKDGIGEKLGVFTYLMVSFISSIIISFVYGWKLTLVVLSCAPIIVIATAVVAKVQSSLTA
QELTAYGQAGSVAEEVLGAIRTVIAFNGEQKEVNRYAEKLIPAEKTGIKRGMWSGVGGGV
MWFIIYISYAIAFWYGVQLILEDRPKEVKEYTPAVLVIVFFGVLAGAQNMGLTSPHLEAF
AVARGSAAAIFQVLDRVPTIDSLSKEGQKLPAVNGEIEFKNVHFQYPARKDVKVLQGLNL
TINRGETVALVGGSGCGKSTCLQLIQRLYDPHKGQVLLDGVDVSKLNVQWLRSHIGVVGQ
EPVLFDTTIRENIRYGNDSITEEEMIKAAKEANAHDFISKLPEAYDSPVGERGSQMSGGQ
KQRIAIARALVRRPAILLLDEATSALDLHSEATVQRALDAASKGRTTIVVTHRLSTITNA
DRIVFIKDGQVVEQGTHEELLALGKHYYGLVSADASATARAKATASAAKTVTAAIPKQKP
PLKRQFSTLSMHSHRLSLAGASETSANQLEEHEKPYDAPMMRIFGLNKPEWPYNIIGCLA
AAMVGASFPAFAVLFGEVYYVLGLQDDEEVRRETVNFSILFLVVGVVTGLGTFLQMYMFG
LAGVRMTTRIRKITFAAMLKQEMGWYDEDTNSVGALCARLSSDAGAVQGATGTRVGAILQ
ALSTLVLGIGLSMYYTWKMTLVSVVSIPLVLGAVFFEARVMSGQGLQEKKKMEAATRIAI
EAISNIRTVASLGKEEAFLQRYCSELDHVAEATRIRQRLRGLVFSCGQTTPFFGYALSLY
YGGALVATEGLNYQDVIKVSEALIFGSWMLGQALAFAPNFNTAKISAGRIFKLLDRVPEI
ASPPDSEDKDLDWKADGLIQFSKVEFHYPTRPEMQILQGLNLIVKPGQMVALVGQSGCGK
STCIQLLQRLYDPISGTVTMDRRDISSVSLRNLRSQLGVVGQEPVLFDRTIAENIAYGDN
FRLVPMDEIIEAAKKSNIHSFVSSLPLGYDTRLGSKGTQLSGGQKQRIAIARALVRNPRV
LLLDEATSALDTQSEKVVQAALDKAMEGRTCITIAHRLATIRNADVICVLEKGTVAEMGT
HDDLIAADGLYAHLHALQEAAME
NT seq 4032 nt   +upstreamnt  +downstreamnt
atgacacggcgaatttgtcagtggacagcaaacccgcgcgagaaggcgcagggtatggaa
atggaaccccaaaaaacaaactctcaccgccaggaaaaaatattcttgaagtacacgctc
caagacgcggagaaggataaagaggaaactgagtatatgctacaagagaatgggaaacca
attgaatttgtgccaccacaaacgaaggaggaggagaagtcgccttcggagccatcccta
ccgccagtgccttacttcaaactctttcgatttgcaacatgcggggagctgatgctgatc
ttcggcggcctgatcatgggaaccctgacaggcctgtgcatccccatctcgacgatacaa
tacggcgagttcaccacgttgctggtggatcgaaacatgaagaatcacacgagcacgccg
accctaataatgaagtggttcggtggaggaaaggtcttaggatctaattcgacgtacaag
gagaggatggaggcgctttacgacgactcggtcgcgttcggcgtttcatccgcagcgttg
tccacgttccaattcgtgtttgccgtgttcacggtcgatttgttgaacgtagctgcatcc
agacaaatcgttcgggtacgcaagatgttcctccgctctgtcctcagacaggacatgacg
tggtacgacatcaacacgtccaccaacttcgccagcaggatcaccgaggatttggacaag
atgaaggacggcataggggagaagctgggcgtgttcacttatctgatggtctccttcatt
tcctccatcatcatatcgttcgtctacggatggaagctgaccctggtcgtgctgagttgc
gcgccgatcatcgtgatcgcgaccgccgtggtcgccaaagttcagagctccttgacggcc
caggagttgaccgcttacgggcaggcggggagcgtggccgaggaggtgttgggcgccatc
aggaccgtgatcgcgttcaacggcgagcagaaggaggtgaacagatacgcggagaagttg
atccccgcggaaaagaccgggatcaagcgcggtatgtggtcgggcgttggtggcggagtt
atgtggttcatcatatacatcagttacgccatcgcgttttggtacggcgtccaattgata
ttggaggacaggccgaaggaggtgaaggagtacacgcccgcggtgctggtgatcgtgttc
ttcggcgtgttggcaggcgcccagaacatgggcctcacgtccccccatctggaggcgttc
gccgtggcgcggggctcggccgcggccattttccaggtgctcgatcgcgtgcccacgatc
gacagtttgagcaaggaggggcagaagcttcctgccgtgaacggcgagatcgagttcaag
aacgtgcacttccagtatccggccagaaaggacgtgaaggtgctgcaaggcttgaatctg
accatcaatcggggcgagaccgtggccctcgtcggaggatccggctgcggcaagtccacc
tgccttcaattgatccaacgtctctacgatcctcacaagggacaggttctgctggacggc
gtggacgtgtcgaagctgaacgtgcagtggctccgctcgcacataggcgtggtcgggcag
gagccggtgctctttgacaccacgatacgggagaatatccggtacggaaatgacagcatc
accgaggaagagatgatcaaagcggcgaaggaagcgaacgcccacgacttcatcagcaaa
ctgcccgaggcgtacgacagccccgtgggagagagggggtcgcagatgtcgggcgggcag
aagcagaggatcgcgatagctcgtgccctggtcagacgaccggccatacttctactggac
gaggctacttccgcgttggatcttcacagcgaagcaacggtgcagagggctttggacgcg
gcctcgaaggggaggacgacgatcgtcgtcactcacaggctgtccacgatcaccaacgcc
gataggatagtgttcataaaggacggccaggtggtggagcagggcacccacgaggagttg
ctcgccctcggcaagcattattacggattggtgtccgccgacgccagcgccaccgccaga
gcgaaagcgacggcctcggccgcaaagacggtgaccgcagctataccgaaacagaagccg
ccgttgaagagacaattctccactctgtcgatgcactcccatcgattgtcgttggccggc
gcgtccgagacctcggccaatcaattggaggagcacgagaaaccgtacgacgcgcccatg
atgaggatattcgggctcaataaaccggaatggccgtacaatatcatcgggtgtctggcg
gcggcgatggtgggcgcctcgttcccagcgttcgccgtcctcttcggcgaggtttactac
gtgctgggtcttcaagacgacgaggaagtgcgccgcgaaaccgtcaacttctccattctg
ttcctggttgtcggagtggtgaccggcctcggcaccttcctgcagatgtacatgttcggg
ttggcgggggtgcgaatgaccacgaggatcaggaagataacgttcgccgcgatgctgaag
caggagatgggctggtacgacgaggacacgaacagcgtgggcgccctctgcgcccgactc
tcgtcggacgcgggggcagtgcagggcgcgaccgggacacgggttggcgccattctccaa
gccctgtccaccttggtcctggggatcggcctgtccatgtattacacttggaagatgacc
ctggtctcggtcgtctcgatacccctcgtgttgggcgcggtgttcttcgaggcgagggtg
atgagcgggcaggggttgcaggagaagaagaagatggaggcggcgaccaggatcgccata
gaggcgatctccaacatccgtacggtggccagcctcggcaaagaggaggcgttcctgcag
cgctactgctcggagctggaccacgtggccgaagcgaccaggatcagacagaggttgaga
ggattggtattctcgtgtggtcagaccacgccgttcttcggttacgctttgagcctttac
tacggcggcgctttggttgccaccgaggggttgaattatcaggacgtgatcaaagtgtcg
gaggcgttgatcttcggctcttggatgttgggccaggcgctcgcctttgcgcccaatttc
aacaccgccaagatctcggcggggaggatattcaagctgttggacagagtcccggagatc
gcctcgccgcccgattccgaggacaaagatctcgattggaaggcggacgggttgatacaa
ttctccaaggtcgagttccattacccgacgaggcccgagatgcaaattctgcaggggttg
aatttgatcgtgaagccgggccagatggtcgctctggttggccagagcggatgcggcaaa
tcgacctgcatccaattgttgcaacgactctacgacccgatttccgggaccgtgacgatg
gacaggcgcgacatctcctcggtctcgttgcgcaatttgagatcgcagctgggcgtcgtc
ggccaggagccggtcctcttcgaccggaccatcgcggagaacatcgcctacggcgacaat
ttccgcctggtgccgatggacgagattatagaggccgccaagaagtccaatatccacagc
ttcgtcagctctctaccactaggatacgatactaggttaggttctaaaggcacgcagctg
tcaggaggacagaagcaacgtatcgcgattgcgcgcgctttggtcaggaatccacgagtc
ctgctactggacgaggccacgtccgctcttgatactcagagcgagaaggtggtgcaagct
gccctggacaaagcgatggaaggcaggacctgcatcaccatagctcatcggttggcgacg
ataagaaacgccgacgtgatctgcgtcctggagaagggaaccgtcgcggagatgggcacc
cacgacgacttgatcgctgcggatggcctctacgcccatctgcacgcactccaagaggcc
gcgatggagtag

DBGET integrated database retrieval system