KEGG   Apis mellifera (honey bee): 551259Help
Entry
551259            CDS       T01057                                 

Definition
(RefSeq) titin isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ame01001]
    551259
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ame04131]
    551259
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ame04812]
    551259
   04147 Exosome [BR:ame04147]
    551259
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     551259
Protein kinases [BR:ame01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   551259
Membrane trafficking [BR:ame04131]
 Others
  Actin-binding proteins
   Others
    551259
Cytoskeleton proteins [BR:ame04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     551259
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   551259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set Titin_Ig-rpts fn3 C2-set_2 C1-set Ig_4 SH3_9 fn3_2 SH3_1 SH3_2 fn3_4 Spectrin Pur_ac_phosph_N Baculo_PEP_C
Motif
Other DBs
NCBI-GeneID: 551259
NCBI-ProteinID: XP_026297592
BEEBASE: GB47977
AA seq 21305 aa AA seqDB search
MPTKNLEVVDILEALESKLAYIPGGRDREGRPLMVVNVPSELQPTTKPRLEVLIAYFLSI
FSEETKKNGLVLIVDARKGAWRVARSCIRLSTVLLGASAASVIVVRPDGFWDKRVDSCTK
SHKEGEPTYLTLTRLQLHVDFAQLPYELGGNKLYDHVDWIQKRVKVEDYTKDASDLITKM
ADLHRRLISLDGFRMSESDDDLESYWGMSNELTAHARHILQSGRNLVGSMARESSKDTLD
STKRIHELIDSIELKKLDIENSWSEMEKNLDTARVIGDLEKGVSRVTDWILGPADAMLNS
CCQVGFDVSSSEELRRRHEELELECRETYGRYAELLHKIDSLPSTRLSEDLKSQRDFMDF
VCRSFANRLERRRNVLITSQRFFRLVSEYFDKTSEVFDKLVMGNRTHDFSQAGVNLLKLQ
QSQGILESLERELVKEGEKLSDILSMPVKDALGRDVHVDYGEDIVNVRDILDATNARKNI
FNDSVELQKLSLKQTALIYIYENDGEQAVKWLNDLYNVLLKNHMEIGCNAIEIQSQKEEH
QSFQETAKGTYDYGCQLVNGARVLRLSCRLPLESNASLFSRLRQAWKRLRSVGQEQLTRL
RVCAVFHRSVEDVRTHCSKLHDLIETVVSLRRSLRLEDLAAEARAKAEIRNILGNREKLL
LEVGRMVRLGRLLRTRLKEPLCHQRMSEAEDASSGKGSNLTAVEAISARLAEVTRLAEKL
DAKLCEAGARTRPVPMSSSAVSSTPSPLSSSSAPPTSASGQIHTISAVTTSSIGITAPLI
SSSTVQLQPKCVSTILSSATSNENVGTTTKDSAQSVNGTGVGDEKVESKVEDEGEAGTGE
ENRQDDLSGMNDEKLKGEVVEDVIEKSFDDNLAEDSNMDEYVTATECSITPTVRSRSESF
VTSPEWEDLAAPTSVTHTCCDTGWNIEETKLKRTESLETEKIDASMDIPKPEVEGTENEG
KQSEKLVSMEKRVEEKSGKIVKEVTETTTLRVSHDTRLDIASYKVISNTTQDHRENVDVK
EIKDLERIVLPDVHEKTNGSHYEMDSVSKSESYSRRDELSTKTDDIERVVKFAKICEINQ
ESRTISVDTSAKDIALSLKEYRRRHEDSGIEMSPTKKDENLEGQDFLEAARKRRVARMVD
GHDSMETAENSEGPREKESRTMVESNEDGTQQTTSPTTTISTIAVQSGETRLVIALLQSG
EWLRLKVLEVQPELTKLGATVEEATELSNAHDEVLLRLQSKQSPVEELLRQADQLISNQR
PRAEVYAAMAETLGQAWRDVNELLERRKQILDSNVLFQCRAEECRESMRALEMACNDTLL
PIEIEAVKNFLSKIHDLRKNMLEALMGALQEGKNLLDRLKEIANEGTLDSRPERIKLEAD
HAVLKVEKWLEELHDRRRLIEASFRSRKTQLEQCLALALLATDLRDLEEILNDRIAALSS
SCDQLGDSASSAELLLFELKKLQAEAKEFQDRSIKITKSTERLVSSGHFAGEQATEQAYA
ILGAAADYVNDLDQYESLLNRAVAFFDSARSAITKLDQLEIQLVTTEHPPYSTRLARFHA
QTVATIEDVTAKPLAEGYALLDITGRGAPGAEGVKRAVEELENRKIRLMERCTAHEKENL
EISRIINTFLDKHDELRKWLMSIPEAFLQGHQDMGSDVTMAEDFCRLHRQLLTDLEQRTV
EVEHLEFEILPIRERLDESQKLELQSKVEELKNSWSKTKDLVAGRIDLGSLYLQFHVVVE
ELTKEIESIEAELKRHVDVLDEGRIESIGRRWKDLQPLYVRLTGTGKAFLDAAVKIDDPY
LDVQRACICVQMLLEKFANKQLTVTESWEKWRTTIEILREKRIEHERKIEESTRTMEWVS
KFSEQLYPVITSVSHQTANILQDLAGSKDRILPELNKAVDELDSRIKGLNALAQKGEVQI
EDEILKRLRQMHENLRTTARDYENLLESLISIFKNIEEVEHKIEQLKSQASRVTSLRKLS
EVEALFNELDAMRWSISERQSQIGSKVRETMVKIERQEPREAGVHDIEKLRRALDSLSTD
FEVFWSQTTTKIEEYRRTYTFAEDLERIDNELLDLNEHLKKVDTKIGENLQTARAAASSF
VQFEKTVTILEERIETFVRTTEESINVLTPQIIKDISSLRERWRNLKRKIEETRKRTNLA
IEYFMLLEEAKEWNREGSKLLVVIARKATTVKTPKDAMVLLQEIENYLKPGEEMQEKRIE
KLKELSTIVFDTDRLPQFNEVVVENRQMLDSFAVISSELRTLAQNLKNAEDLQEKLRIEK
READEKLQAAKMEMAAAEAAREEAENAKKIAEKLAAETLEKATIEAKRLKEERKIQKVSA
PPSFSVSAQTEKIETDESYVKEMVTSATIKKEIHILQKTEIEKRVPSREPSPQKKIITEE
TREKSVERMHKESVPPLAPEFTIPLHDATVQEGEKFTFQCNLIGQPTPEVIWYKDGISIL
NNPDYLTTYIHGICTLTIEETFAEDSAKYTCKAFNIAGSAETSATLTVKETAPEEQPSSP
VFVKELMASVALENSSHQLNCTVKGNPLPTVQWFKNDVNIDNSPDYVITYNNGEAVLKFE
EVFLEDKATYTCKATNKLGQASTSAFLDVEPAEFTSEKPYFVTPLSNAMGRAGQRVKLEC
EAKGNPMPALTWYHDGRPVEESMNLKIQMDGGRTSLVISEAFAKDAGCYTVVAKNEAGEA
TVTCNVSVKGRLPHETSDSEFACSDMEPVVPKIQMPLKDLKVQEGLSVRLDCVIVGQPEP
EGQVIWYHDDQPVKESADFQLLFQGDKCSLVIHEAFLDDAGVYKVVAINSGGEASSQCTL
TVTPVTVSEKLDRARTEIEETFVAGSPPRFVKLPTDSLVAEGETAIFECAVVGEPKPELR
WFSDSGEVTENERILIQRKEDGTSILKISSAIPEDKGNYVVKAFNEHGEAKAFARLVIRS
LGDFRRKEEFVKMEEKLIAPTFKERFEDRRVMEGVSTKFECIVVGKPSPKIQWLFNDRPV
HGKDFLVSVSGDRQVLTIPETGSTHAGTISCVAENAAGKAICSARLEIGGRSVEEVRKVG
EKRVVDLVERSPADEMHAASSSEKHFSSEKSEGEGESQVLTKMSQTITESTTTHKTTKKE
YISSTTSSTLSKPGQEPTSVSVKTTVHSTEQSSSENGAPPVVQSYKVEEHEKIIQDQPGE
IRQEKTVVVSQDEEGIKQRDVKAAQISKPTRKSTAPRFVSPLTGMIVDQGTDIILEGIID
GFPQPSISWSKNGQELKTKDGITITYAHNHVRLELKKVNVKDAGRYTCTASNEVGSASST
ADLVVKKTIFPPVFGRRLQAQVVKRGERVNMEVEITGTPEPTVTWFKDDVPIKERPPELR
IKQQGNCYMLIIDKAEKAHAGKYMVRATNAGGEAQSIADFAVFEPTPDTMTEVHKTVIYE
NVQDKKVTQSDEKKKEVPSSKLPPSTTIQQIPPLKTTPIVSSTSISETTKTVEKIEEPES
RMSRSETISSTVESHQSQSKSEQKFHMKLEHKTPIIPEPRKEEKMVTREVIREEVEKKGA
EPKATVIEERTKIENENIETSTIAKKDALSFFESMTKETETTPKGPKEMIKLVDDADGHE
VKVGKLTKNYERSTTFQEVKKPEPKPAEIQTTKKAVHEIFTKLEQGSTASRGIDNKLFDF
PYEPYKPPSEIKKTVVEETVSSGSSSVQGSLIMSSKMESKVESKMESKSELLEGFNLVPE
PPPEIGYMPKPEELKKKRPEVSIKAKQLQESFDRTLSPIDAPVGGVKIFPTPSPKVAPMF
SMPPSSFELEKKEVVEEPCVRKEIHEKRDYVSSFRAMSPSRPWSSSSDVETRSHVSTDLS
EYRCHSAASSHQEILRSTSPRPSADALAMEKSWAKKCAESSRKSWPPQEESKFKQEWQSP
GEEYKSSSKEFRKEVEETPEGGIRKTSMESSSTTERRSWSSKQESMEKIESKRAPSPLKT
QPIIYNAETIKVDHVVNKMEEKSLYEKYTSESDIKKLEKSEKFEEKYSKKWTSSDDLKAP
GLVRSVEPPKRPVIQLYHLTPPSEQIILEPGPPPEIGYIPAPVVKEKKIEKIEKNLEVSL
EHQPAKIPPGGIRTIPPVPKKEEPPALPPKDVKMTPPPIPAKQPTPIEPLEPFPFKPSPS
SAPMKKVPPPPTPTKFVKGSFTQESDYESDMDGHMKAKWRPYESDSEEPRYRRVQAPVPK
PSRPRSTEPEPLPPSKFEVPPSTVGPPRPVITKEQQEKVCKKTIATTVKRQEREIKQQQQ
KFQVGQPPAIELKPGSPPIYVQPVKSPTPKSPPVKKPESPKFKVKTFQQESGYMADTDEP
FQQKSSIQSVQKSFGKHESSSSMTSHTESRTSYSESRSEYFESKSYDSRQQQQQKKESFI
APPAPLITKQPVQPPVQQQRSSFVEKSYISSTSPSRFSSTKETIYTTDQSHKKLETTKKI
LPPSPSPSKFVKGEFRESDYESDYDGRIPPLWKPRGYESDDQSFRSVKPNLAGPGKPKEP
RAPFIEELEKKKEDRVATPTKPKTVLLPGSPPEIAYAPPQPTYYEARSGIPFHNAIGTET
KKTVRMDESTENSRRIVTVEQTSRVIKFGDQKPTATDFTGFEGSDQRQKAAFKVPTPKKF
VQGQFRESDYESDIDTRIRAKWAPPESDTEEPRYRKVQAPTTKAPRSASAPVRQEHVVSP
LEFDTGPPVLKRQTSMTQLRDEGRATQVKRDVCSGQEEVLKPGSPPEFGFISRSDVKKAA
THVASRHMSDMTTSFKSKTEKFVSDIQSDLKQGKPILKHPADSRASDGDEPRTYREESRH
SEHGTKHIDPDTGLIYFKYDFGYEFGIVLPGEGKRTVTSTNRTIQGQRRASDIEVPIVHE
FTTTRRENGFAKRSSSTSSSTRQGKPTGKFGTSKTVKWEPTSESEFSEAEDVRNARKRQQ
DGGSAMAPPSLVIPCSPSPSRWDHTTPSPLSLSPSLPSLSPRYSSATGPPSNVDSAGSPW
PTTNGVASSKEVIQPYLEILPKKAPLFITPLKDIAVVSGQTARFECIVQAEPQPNILWSK
DGRIIENSSCYEIHYRNGVCRLTIVRAFPEDAGTYACTATNSLGSTVTSATLQVPGVPSP
FYGTYRDQNINERAMESPPRYVALKDLFLPQENDVKSIPADRQHSTRHDYSVPWNLNADP
SCAGGGYRERRITTEECEEITDRNTIARRLGYSDFEANDSFRDDFCFDREYCRSARPRTE
DGVQGEIVMQTTPTVPTFTGRPGDPSPPVFEQIFKNARFAQGGNAIFEGRVRGNPKPIVC
WTHKGAPLLESWKIHMSYDEKTGAVTLQINQIGPGDEGEYTCSAKNQYGEAICSVYIQPE
GFGPPPQQQMGGYRKEFAQTFQSTEQKTQTGTQSFQQRSYQQTIDKRSYVNGTSVSIEDF
KVDTFEYRLLRETEFRESITRRFVGESDVQISTVVDRNLGPVAPPQITQKPRNSKLVEGS
DAVFTAKISGNPKPRLTWFKNGQRIRESQRVEMSYSNQQASLRIRVALPEDSGHYTLLSE
NPQGCTVSSAYLAIESSDQVDQAYQAQRETIKTQQVETIGETDSGKVLPPNFVRTCTDRD
ATEGKMTRFDCRVTGRPYPEVTWYINGQQVANDLTHKILVNESGNNSLMITNVSRADAGV
VTCVARNKAGETSFQCNLNVIEKEQVVAPKFVERFTTTNVKEGEPVVFMARAVGTPVPRI
TWQKDGVPITPGPDVRISTDGSGASTLDIPYAKLSDAAWYQCTAQNVAGSTATRARLFVE
TPKGAAPEPRRLNLPRPTKVIEPEPAPGPEVIYLRHVERAKPYLPPPEEDRIYPPPRFII
PLKDVHQIEGGRIHFEARIEPVGDPTMRVEWYVNGRALDASSRATSIFRFGFISLDLISI
VLQDSGEYLCRVVSSTGVAESRATLSVTPRATIEQTSQHPDSLQYIQQLEDYSKYQRQES
VEDISPQRPVFIRPLQDLGELQEGRNAHFEAQLTPVSDPTMKVEWFKDGRPITASSRITT
IFNFGYVSLNILHLRAEDAGSYTVRAVNRLGEAVSSASLRVFARTSVTTDLGIPEQQRYI
EAAEELEAYQQAMHQKYVQEQPEPTSPPEFKSPIKDQNSIREGGFAHFEARLEPVGDSDL
RVEWLKDGRPVEASSRITTFFNFGYVALTIKYVTIHDVGIYTCRAYNRVGEAHTTAQLSV
ISKNDVIYDSQHPTGLQKIQTLEDSSRYSRQLQEETQVTQAPRFLGTLKGTNKIVEGQRA
HFEARVEPQSDLTMAIEWYHNGKPITAANRIQTYHDFGYVAIDILQVRSEDAGTYTVVAR
NSLGEARLSATMVVETRSSVDTSSMHRTSYEKTQRLEESKFVEPQYHIEEISKSKPIFVQ
PLSDPKPVSEGKNIHLECRLEPMGDPTMRVEWFQNGRPVTVGSRFRTYYDFGFVALDIVH
STVLDSGEYTVRATNHLGTAHTSACVRVIGKSDVVTETQHEQSLEQIQMLEDSSRYRKTQ
QEEVTVMQAPQFTRPLHNIETVELTNVHLECRLQPVGDSTMRVEWFVNGRPVKTGHRFRP
SYEFDYVALDILGVYPEDSGVYTCQARNQLGEAVTSCSVRVHAKKDLLLESQHPEGLERI
QYLEDASRYKRQEMVDEVVTVKPRFITAPKSQENLREGEHAHFECKLEPVTDSNLKVEWF
KNGRPVTIGHRFRPIHDFGYVALDVIDLIAEDSGTYTCRAVNLVGSDEVSCTLTCRSTAQ
VLTDSKNEIGLEQIHYLEDRSRYQRREDVEETTTQAPIFTTSLNNVEIKEGQRAHFECRL
IPVSDATMKVEWFHNNKPVKAGSRFVETNSFGFVALDIMYAYPEDSGTYTCRAKNIIGEA
ITSASAVVHSKKSIYTESQNEETLQRLHYLEDTSRYQRKTTTEEIITQAPVFTMPIKDLK
VAENQAAHFEARVIPVGDSKLKVEWLRNGVPIAASNRVTTMHDFGYVALNMKYVNPEDSG
TYTCRAVNDLGEAVTSATLFVQSKAALQFESQHESALSKIQALEDTSKYQRREEEEIVVK
ERPSFTVQLNGPTALVEGQSAHYECRIEPYPDPTMKVEWFHNGKPLSTGHRYRTTCDFGF
AALDVLTVYAEDSGTYTCQATNRLGSAKSSINLDVKSRSSIIRETQHESALKKIQYLEDD
SRYKRVEEEDLIVAERPKFGRPLKNIEHLPEGKSAHLEATLTPVNDPTMVVEWFRDGRPI
PQGHKFKTTYDFGYVALDILYAYPEDSGTYMCKARNAVGEAVTTCVISVDSKQGLYLDTL
DAQRLQKIRELETVEVKQEVEKEVVHQKPVFLTPLNNLDHLKEGEHAHLECRVEPINDPN
LKIEWFVNGVAVKTGHRFRKTHDFGYVALDILYTYPEDAGTYMCKATNLAGEAVNTCTIK
IGSRRSILLDTQHPDGLEKIRELEAQGRPARLEVEEPPVTPPRFVTELRGTTEVYEGQTA
HFECQVEPLHDANLRIEFFHNGKPLPSASRFHVTFDFGYVALDIGHAVPEDAGEYSVRAI
NALGQCVSSIELRVIPRDNIILDSQRPEGMDKIRELEAQQPWKRPEVPEPQTRQRPVFTQ
PLQNIDAIPEGHTAHFECRLIPVGDPTLKVEWFRNEIPLETSSRITKVHDFGYVSLDITH
VREEDEGVYMCRATNPLGEAVTTASMKIRSKASIQLDTQHPEAQRKIAQLEADKGPSRTE
EPEKVFDKPIFTQLLTGPTELWEGQTARYECRVVPVGDASLRFEWYINGVELKMGSRFHV
SHDFGYVTLDILKVITEDSGVYTCKAINKAGEAVSSISLKVKARSAIDAESLQPDAWQKI
QLKEAEMNKVPEMFVDTTPQQAPVFTKHLESYDKLVEGQHVYLEAQVEPRADPNLRVEWF
KNGIALQTGTRLRSTFDFGLVTLSINGLRSDDSAIYTCKATNLLGEAVSTCSLKIVDRHW
LLGDTLHPDALPKIDALEQPHVTTVEQPEPIYEVPVFITHLNNVECVEGDNAHFECNVEP
SKDPTMKIEWFINGKPLPTGARFKSTYDFGYVALDLTHAYEEDSGVVIVKATNSKGSAQT
SGTLKCTSKQSIYLQTQHPQGEAGLEKVKEVEDAYLSKLKRPDAGPEQEYPKPVWTVPLQ
PEFKLGESEPLHLEGQVEPKDDPNLKIEWYFNGKALEHGSRFKMTSDFGFVTLDLTDVYD
RDSGIYTCKAYNKAGEAFTSTTIYCSTKENIIEKSQHPKGKEGLEAIQDLEESLKRQEGA
PPESEEGHPPVFTSQFENLTNLSEGEIAHFEASLTPTGDQTMVVEWFYNGKSLEASHRTR
TVYAFGMVVLEVLGTKIEDSGTYSCRATNKWGQAEISVQLECVDKSKGQKPKFTTHIQSL
EGLKDGQSAHFECTLIPVGDPHMKVEWFHNGQPLRHSSRFKMVSDFGFVVMDIAGVMAHD
TGEYVCKASNKFGEDYTKATLKCFGKSGVYLDSLQPDSLARIRELESYGGEQPTTPTTPV
AEPPKFITQISDITKLVEGQSAHFEARLTPVNDPDLKVEWYYNGKKLPHGHRYRTFHDFG
IVILDILYCYEENSGVYECRAFNKYGEDTTKATLKCYSKSSLILESQLPKGMEGGLEKIQ
TLEDSMIRTRDEKVVEERGKAPVFTVPLSNIDGLREGESAHFEARLTPTDDPKLKVEWFW
NGKPLRTGTRFRTFCDFGFVILEISPIYPEDSGEYSCRATNDYGEAVTTCTMKCTGKRSI
ILESQLPKGMEGTIDKIAELEGLGNEPGEVIPDDDTGKPPEFITTPSDLTLTENSLAHFE
CRLTPINDSSMRVEWFHNGKPLLAGTRIKTIHDFGFVILEVANCYQRDSGLYTCKATNRH
GEATVSCKLQVRGRQGIILEPQLPTNFKTGTESIQKLEEALYKKDEILTEEETPNPPKFT
VELKDIEVEEGAPSHFDCRVEPVGDSTMRIDWFHNGRSFATGSRVHQINDFGFISLDMSY
TYARDSGEYICRATNKWGSATTKATITCKSKKTIDFDSQLPSGMSGEKLKELERGPVSEP
PPAEEPPRQPPKFITHIQSATVDESEAVRFECRVEPKDDPNLRIEWYRNGKLIPAGHRYR
TMYDMGFVSMDILYVYPEDSGEYVCKAINDLGEDTTRASVSCKKLPNIILQNQVPKGMKK
SEALMQMEATIKKYTSEVHLTEDDLYDADKKQPPRFVTQIQDQTELVEMNSTKFECQLAP
VGDPNMKVEWFFNGKPLPHKNRFTPIYDFGYVAMNFGWVYPEDSGEYLCRATNLYGMDET
RAVIRTAGKPGIIYESQLPKGMKSIEKIREMEAAWQIVPEEEGEEEKVRAPPTFVSKPEP
VTVEEGDWSRFCCRVTGHPRPRVMWIINGHTVVNGSRYKLTYDGMYHLDIPKTRQYDHGK
VEVIARSSVGEARTETTLTVKPRSDDYRGVLKNSPRPWYDYGLTQYQTERQNTELERVFD
ERHHNISQGIEIATEHLGQKVYKEPETEWQKSVKSKKNEDYYNKLMTLEEEQVLKESRLR
ESSHQFAIPGEKVVAHSVAKGMAQQYEETLEDKKDEKIQETQQTTTKFVKKPHTTEVDID
MERVKGRYPPEPSESTVHGREVHVAKQKQIQKEVKGDLEITRKITATETTEVEHKAKTQE
RIVQGPTKPAKPPVFTKKIQPCRAFEQEQARFEVEFDGDPLPSIKWYREDFPIQNSPDLQ
IYTFSTKSVLIIRQVFMEDSGVFSVIAENRGGKAKCSANLVVEERRRQPGRGGVVPPSFL
STIQSTSVTTGQLARFDAKVTGTKPLDVYWLKNGKKVTADIRYKTLEEDNTYTLLILETI
PEDSGKYECVAINSAGEARCDADCMVRGPQSPAKTAKPTTPGVEKAPQVLEPLKDQTIRE
GTSVAFACRITGKPVPTVQWKKGDKVIKPSKYFQMQKDGDLCTLRISEAFPEDEGVYKCI
AKNPAGDVTTSANLRVLAPDATDVLPKLSPLKDQIVFEGQPAQFKTQVTPAKPKPTIQWY
REGALIPQSPDFQMIHEGNNAVLLIATTYEEDTGTFTCRATTSAGTVETSAKLIVKKRKG
AYYEVPTETGPGVKSSTNYGRDIILEPLTLDENGLPLESLPLQSGDESLPWRKGRVHHRP
RLGDVTPWRKSKSRDTSLDKLQAVEGQVKPWTEEAVVLKKTPQVPREMPREKLEEVELKP
TKIEKKDIARASLEAVDLKPVLREMTKEIKTEEEKITQLDKTTEEIYVEEEDSRFVKTSK
RIDETVQRKKEEVKPWTEEKVTLKKSKLDRKEIPRETLETVELKPSKIVKKEVDKATLEK
VDLKSIPIVTEKITEETISKSEYLEQEDTSMLDVTKIEEVKKLKKEKIEEKMEQTKPWTE
EKITLKKSKPEKKEIEKKTIEIVELKPSKIEKLPDRKSSLEKVDLKPVPTAVTEKITEKK
IIEKTKYFEEEDTALLEVSKTEELKKMKKDKVEEKPEEKPKLWTEEKVTLKKTKPVKKEV
EKETIETVELKPSKITKTSIRKESLETVDLKTVKKEREKTMKEIVQKTDYIEQEDTTLLD
ISKDTQVKKTRKESISVEKEHAKPWTEEKITLKKAKPEKKEISKETFETVQLKPSKPEKA
DIEKSSLEEIDLKPIPKKEIPKKPEEKEVVVEKDDTTLLQVAKDTETTVKIDKKVKKKEE
TERKTSETKPWTEEKITLKKAKVEQKEVRRESLEEVILKPTKTEKREIKKETLEKVDLQK
VTDKTQFVEKEDTKVLKIDREEKIEEDKIEKVATWRKERKLKEPYHEEEDKTILDVEKDI
EFMEKQKEMPVPWVRGKKKLTEKVPYHKEEDTTLLDIEKTEKTTEKQMKEEVPIPWARGK
KAKKEKSDVPQKVEEKPVEEEEKLETMQVPWLRDKKMTKKIPEKKEELADDIKSVTLKPV
RREHVPEEKEKLEEVTLKPVKRIPREEEEKEEVQLKPIPKRKSEEKPREEVTLKSFQKPK
QEEEKSKKPELKPLEKSKPEAPEKEKVQLKPFQREKPEEKLTIISQKLPEKTQEKEIKEV
EEISWRRKPKKPSISEESPVEKVAEKIVEEKVIKKEEETIEDFKSIALKPIKREKKPEER
EDKEEIILKPVKHIKKEEESTEEIKLKPVEKPEKKIEEKEEKPLKLIEEEKPIESELPWR
RDKKKSIEQKVTEIPIEEKKVEEEQVEVSWRKPREKVMKEVQKEKVEDFTAIKLKPARKE
KRPDEKIEKEEVVLKPIEKIPKEEEIIEEVTLKSEKLEKPETFENGEILEEKTELPWRRG
KKKLAKEEVKLEQILKLEKQVSKSVEEQIIFKHKDEKPEEKEISEIKLKPVKHIEKPKEE
KPEEVKLKPVKRLPKEEEEKEVVTLKPIKKEKPEEEKPELKLKPVKHIEKPEEEKPEEVK
LKPVKRLPKEEEEKEMVTLKPVKKEKPEEEKPEEVKLKPTKKEKPEEEKPEEVKLKPVKR
LPKEEEEKEVVTLKPIKKEKPEEEKPEEVKLKPVKRLPKEEEEKEVVTLKPVKKEKPEEE
KPEEVKLKPVKRLPKEEEEKEVVTLKPIKKEKPEEEKPEEVKLKPVKRLPKEEEEKEVVT
LKPIKKEKPEEEKPEEVKLKPVKRLPKEEEEKEVVTLKPIKKEKPEEEKPEEVKLKPVQR
LPKEEEEKEEVILKPIKKEKPEEEKPEEVKLKPVKRPEKPKEEKPEEVKLKPVKHLPKEE
EEKEVVTLKPIKKEKPEEEKPEEVKLKPVKRLPKEEEEKEVVTLKPIKKEKPEEEKPEEV
KLKPVKRLPKEEEEKEVITLKPVKKEKPEEEKPEEVKLKPVKRLPKEEEEKEVVTLKPVK
KEKPEEEKPEEVKLKPVKRLPKEEEEKEVITLKPVKKEKPEEEKPEEVKLKPVKRLPKEE
EEKKVVTLKPIKKEKPEEEKPEEVKLKSVKRLPKEEEEKEVVTLKPIKKEKPEEEKPEEV
KLKPVKRLPKEEEEKEVITLKPVKKEKPEEEKPEEVKLKPVKRLPKEEEEKEVVTLKPIK
KEKPEEEKPEEVKLKPVQRLPKEEEEKEEVILKPIKKEKPEEEKPEEVKLKPVKRPEKPK
EEKPEEVKLKPVKHLPKEEEENEVVTLKPIKKEKPEEEKPEEVKLKPVKRLPKEEEEKEV
VTLKPVKKEKPTEEKPEEVKLKPIKKEKPEEEKPEEVKLKPVKRLPKEEEEKEVVTLKPV
KKEKPEEEKPEEVKLKPVKRLPKEEEEKEVVTLKPIKKEKPEEEKPEEVKLKPVKRPEKP
KEEKPEEVKLKPIPKSVSEKVEEKPEDEAEKILPWRRGKKTKKIVDFREEVTVVPIDQEK
VITEIHDEEIKIVEQKVEAKKIVQAEIKEFKEEKPELPWRTTKEVKEIIEEKVVVEEIKP
ETVLKEDEVIEDVTESSEVSWRKRRKPKKPEKEKEVVELKPVEKHEEFVERIEEIVLKPV
EKEKFEEKPKEEELKPLKLEKPKKLEEEEIEEEKVTEMLWKKPEEIPVPVEKEVSTQEVQ
VIEATKVEKIVEDVVEVEKKKVQVEDRRRKHKQRTQVEISITDKDKKIAPRFIQKLQPVI
AQPETTAKFTCTVFGNPFPEITWYRNEQELHASEKYIMTIYETTASLEITKVKEEDAGMY
SCRASNPAGVATSTVNLVIFEKEEEGIAPHFATPIKPLMVEEHKPALLECIVTGTPMPEV
KWYRGEEELKPEKGREITFNPETGEAKLHILEPTEEDETIYRVRAVNKFGRAECRANLVI
SNVVRVSKPEVLRSPKITRPLPALVAEFGKPLTLSADFESKPTPEVKWYRNGAEIVPSDK
RVIKIYENTTELYIPEVTKKDGGKYEVRVENPVGEARSSGSVTVKKREDKTDEVKAPRFI
EPLQPQIVTEGEVVIMETRVDSYPTASFQWFHDTRPLESTPQVRIVTQENKSILMIKEIK
PEYSGTYTCRAENVGGSVTCTATINLLDTPWEETVELVSPTFVKRLSPVRVMDGESANLT
CIVQGKPTPRVEWYHDNKPIKEGKEITIVQDTEGVCSLAITEVFPEDAGEYTCRAVNPVG
EAVCTSSLIVEAYEYVPDSEIASSIVATSLTTGQSGSEEDLLSPKETPLFDTDEESAPEI
VKKLPQLIPTKVGELTRLEVKVKGKPKPEGKWYKQGVEIVSSQEFLIEEFEDGTSVLTIA
ETYPDDMGEIVFEVHNPLGVSTTTTYLSVEGIVGTKEYRKPSWVTQMEEMQEALRATQSV
PRFIQEITDVYAKEGETAVFECIYSGNPVPDVVWYKNDKMITNTPNVKIRLLDEEKKTIL
TIKHATEEDDATYVCKATSEIGLTTTKAKLHVTEITGKKIFMDEEQFEEQIVEEKPKKKP
EEEKPHKKKKPEMKKAKETKEKVKGERVKIDKKELHKEKLIPKEQPEEKKIVDIEETQTL
ETTEIIEEQPTEVTRAKKVMPIQEPLITEATASLKKIDDEKAREIILKTEERAKRVLEER
EGVVVSEMAIEDTARDFTIESVVDRAQITSETLQTVSVSEVHTEASVQEIRRVDTKRKAK
KTVVTEEEELPREIVVEEKPKKKKKEKLKVREEVTIEEIVERQKENIAREVEEIMETLHA
KEFGPGEAPLRELATIGFLVRQGVSVNEINESLYKTDNFPALKTPEAQNALVQLVEREGH
GPLITQVLTEETTTDESVVAATVGFRAFMRMIELQHVTVEEVLTHFAPEDFRPRAWEVTE
ATEVETEERITERVDVIHKTEVHFMERRDERKAIRTQDIRDIKEYEDTRQAHTTLRERKL
TKPKEQIEEKKEDRGVGVQVVEIEEIEETETGRKKTKDAEEIEEEIETIIIETDSKHKLA
QKEKKRVDVEEEEIIEKERKELIPKRPHIRRNEVEMEEIEEFEIKEDRSMPSLILNVPSQ
RHQIIPLDRTIEQAPGKPELEKAKLTMDTITPLTEHFVPIQEKEIDDISQIKLIERKASL
SISPIEPYSIMETTVQASTGEFAGIFKPTFYEATRGIVPSESLVISETLANDAGLSSLII
NKQEISKTADVSVALQEATTVYETMVSQKEAPTEDFVSPLTVRAEDIILPQIGLSVYEIQ
EGLTEDKLEPLKTLPTKPRVNIAAVEPLVVEEVRAEDKPGKYYPELVVPTEVATETVIPQ
RQRVTEEMYAPEKEGMYVPGRLPPSQKAQVGISYGNETATVQQNIVQESEGVFISERKTD
TFEATPNVTVLEGISVSTVQAQDIESDLTIEEMKKAVADLNIIEITSAVTSETVPSEKEK
EYQLEDKPAIKTAETSISLLEIGSIASTIIQESEGIYHPDQKPTKVLAETSIKPEEYVQI
SEIQTADYPSDFKEELKYVQESGTIAVQLIEAKMIQETMTHDREAKMEELIKPEERVVKT
SYDAIKSVEVFQTTSIEKEADLKIFEMPESHRGKTVPTHPVVSLEIEMTQPEDNLGMIKK
EVPSSSIAKIEPIALQETIIGETVIAEDVAPVQKDKVPEFKIAEVTMNEIESLHTTMVIA
SEKEAEYIEISEMKGAYATTEFTTQVAPIFEEIRTHSPTEEYISEKKAISSVAQSSHIPL
ESVTIAMQELAEKEDLYMTEIQPNKKIAIVELTEPRPGPIILEVISHDRENVYNPNVKPQ
DYTAETLVSGHKVALKSETLVEQSTANMSIDKPQSKKAIPQRDILEELIVTETTIAETEK
IREADILPTIQSAEIEIQSKTEKLTVIEVTSIQEEEKLEIEKIPKERKVVLGITGGHEVA
EMQETVLASNVNILKEEKIKEDHANQQQSGLEVVEQTEISISEKESPLQKDIRPDIKIVE
VTFQEGESIVVGITHPEDKEGIFTPEEKPKNVEATVDIITQGVASKFEILSDTGLSDLPD
ETVQKMKPKTTILPIEAAIAQEVHTRETEAPFSEIKPNDKKANLEFVTGEGLIISAITTE
DKESLLPETEKPKTKSASFDIPTHFVAQTIETTTTDNVGEFKREEIHVATAITDHITFRS
VITSETATGDLEKPMEDFIQPEKKMIDVSFQEEEGITVIETIASDKEKEYFKKLEMQGEQ
ATASFDAHKVAQLTEINPASISGDLTMLAPITVAAKEERLPFESIVQTETIVSETEKEFK
DKPIITNKAEVSINEIISATTTTEIPADKEDILQIFEKPSEKQASVQFAGHMIAEKIEVT
VDSSAGKLKKIKPVSALAVPSSIPLEAVISSEIQPTEIEGPFIKDKRPLKAIADLSVVEE
QSVQVSAVIMEDKEEEYKSKNLPEIKTAGKSLVSGHIVAETTMQIVDFSTGEFIQEKPSG
AIAISEHVPFISLIESQPIIQESEDKFIPGQLPENKTAIVDLEESKKIVIVSQVTPADKE
SLYISEELPSKHAASFGLDTIHGIAETTTISVEDSISEVKLKKPDTKKASTTQELYQSLL
VTQDIVQDQENTFEEKFKPTVQKIEVSIEEGKRVTNVIEVSAADKEEILKTVQEEIRSVV
PIIVSGHEVAERSEIIPHLSTGEMDIIKPTTATAQVGQKPFETIEMIEQVLAEKEIDKVE
EISPQKTNARITVDENRFIAITEATTAQDVEAEMSIIKKPREEMAKSSMEGKEVAEQMEV
SLREELGNLPVAQRPTTFEAYPTQITLECVDISETIPQEHSTVFEEKMKVDERSAKVSFV
EGKSINISHVISQDKEDTMIIQKREESTAEMTLTKVGMDVAQKAQVFIEQSTGLVQPFEK
REVQAHHKQDALEPIIVEEIPSAESEGVFDKYPKTVFSTAIQTFEQDHGISITEVTSAEV
ESVLKEKKMDISQTANSTLIMERNIVETSMIESQISIPDKIEQISMKPQVAVPEQDTFES
IIVNENIVEESERTFEDVFQPQTQKADIDIQKVTSLQVSETITEDKESVFDVVPKREEVK
ATQDISLHETVIGSLVESVQSIQEIHEEKRISSQATMAQTVIETAVKIETTVGEREDTFE
GKNFKLEQQKGKPQMEGLSTVIVTEIVSNEIEDVLPATVTPKEQQAQPILTGREVPEVTQ
VIAASTTEEFEKVTQLKKQQGKIEMEEMSSVTISEVISNETEDIFVLKTIPKDQKANFNI
LGNEIAETSQVTTIIETEDLALKRPEEQKGKPTLDELTSLTVSHVVSEEAEETLSLAKVP
KEKTAHPSLTGRDVAEIIQILAIASVEKFVASKAPEEQKGKIQVEELAPLTVSQVISQEA
EETLPTPEIPVEREAQPSLISRDVAQTMEILTMANIDTLAEDKKPGEQKSVPGLEEFVPL
SVLQTISTETEDVLVSPKVPTKKIAQSSLTGHDVAETMQILTMMATKELIADRAPEKQKG
KPNIEELTSVMVSQTVFHETEETLEEQVAPSTVIAKPALTGREVAEISQVLTVANVEELE
KGKLPEQQKGKPNVEELTSITVSQAVFHETEETLEKQAAPSTVIAKPALTGREVAEVSQI
LTVANVEELEKDKLPEQQKGKPNVEELTSITVSQTVSHETEEILKQITPSTMIAKPALTG
REVAEVSQVLTEVSIKELEKDKPPEQHKGKLNVEELTSITVSQTMFHEIEETLEKQVAPS
TVIAKPALTGREVAEVSQILTVANVEELEKDKLPEQQKGKPNVEELTSITVSQTVFHETE
ETLEKQVAPSTVIAKPALTGREIAEVSQILTVANVEELEKDKLPEQQKGKPNVEELTSIT
VSQTVFHETEETLEKQAAPSTVIAKPALTGREVAEVSQILTVTSAEELEKDKLPEQQKGK
PNVEELTSITVSQTVFHETEETLEKQIVPSTVIAKPALTGREVAEVSQILTVTSAEELEK
DKLPEQQKGKPNVEELTSITVSQTVSHETEETLEKQIVPSTVIAKPALTGREVAEVSQIL
TVTSAEELEKDKLPEQQKGKPNVEELTSITVSQTVSHETEETLEKQIVPSAATATPALLG
REVAEISQVLTVTSIEELEKRTLPEEQKGKPRLDELTSITISQIVSIELEDKLPSPEKPS
EKIAQPQIAGREVAQKTEILTVTNVEELEKSEKPESQKGRPDVEELSFLTVSEVVSTEAE
KELPTPKAPKEHKALPQLDSIEVAETSEILTITNTEELPKSKIPEEQKGKPQLEELLSLS
VSEIAFGEMEKNLATPDEPTIQTAKPSLIGIQVAQKSQVIPSVTAGELQKEMKPAAKQII
PEQIPFESIEQLQAVAQESEDIFVVEKIGKSVKAEMSFRVSESVEVTQVMATEQESKEVI
KGVAKEVSAQPDVIKHEVALKTEVQLADVADEFKVIKPEGKMAKGVDEIQQSVIVTEPLN
AGEIESEMSESVLPSAKLANIIVEAEHLEHVMDITEEIVEQKAVEEIKKPKIIKKKPLKA
KNEVTEEVVEGIIIEQPDEQEAQPIMEELETVTITEHDVRNIPKKKKEVVIKEEEEIFET
IETPTQKIIRKKIRPMKKGGEEIVVEEIIQKPREETIEMEKQRIIEVIETPIKKVVKKIK
AVVKDDGVPEEIVEEIVIEKPQKEKAKSIIEEEKEKVKVMKIDLKQAPKKPEEIVEEEEE
IIEIIETPMQKIIKKKSKDKKKKIVEEVIQKTIEDAKAMEERKIVEIIETPTKKIIKKKK
AIFTEGKTPEEEVEEIVIEKPVNEKVQKDVVPQEGIEITEIIAETSIEQLPEKKLKPEES
KVSEVEEEKTEITQIEMEKIPKKKKPIATIEPEDKEEIIEEIKPEMKKEKAKPTEKESVE
ITEVISEVITEKLPEEIMKKKATKIKETEEKIIKKEIKIKEAPKEAVPQTEEQLEEEVQE
LITEKLKKTKAKKEVMSQDSIIITEVISTTAEEALEVKKPEEDKAVIIKEKEEKGKVEEK
KVIVKKAKKKLIPTEAEEEQIEEIIEEITPEELKMKKAKKTILPKEEIQITEMIPEIKTE
EIKEKQPKEEKAVPKEEEKVEEEAKITEVSVKKVPKEEEKKEIITNGEIGEKPKVKEIPE
ERPELKEAPKTEKFKKEKPKEIKPEEKEEKLKKKKIPEKKPIITEEEQFDEKIEEIVEEK
PRKVEPKKEIISKETISEIVAEELSTRKPEEHKVISVEEKSDEKFTVEEVLVEKDLEKKE
KEILEEKSIEEIHEKPKEIKKKKKKKIVKKENIEEWVEPEYERPVLEPMPEKIQWEPKKK
KVKKPLPESLQKLVPQKIERKEIKPMKLKYSEPTETVQFAAIKLKKVVIPKKKEIEESKF
PKIMLRSRITFVGDYPPEIQYPKISELEVNPVQTGILSRNTEEALEILKRKVKKIKLPKK
EVTELEKLDQEFEELKKVPLEKIEDKLIYERPPKKPAEKPEEPQKLVVGKGKVPEEKKAE
PEMMKLKKIPEKKPEKIEEPLKKPVKPESEEKIKAEKKEKPKMKLEHEELRPLEFDKSEL
EKYVPEEHEESEKPPPEPMPKPYEREKKKKPDQEIEQIPLIKGEPKLPEPDKEPEVKFRI
PQKEKPEEEPEKITLKGWKKDKPEDEDIKEFPAKEEEEEAPTAPKKEAEEIILKRKVKLK
KPKEKATKEEEVTFKKPEEKKPKEVIEEITLKKEPEKSMEQVPEIFIKKPVVEEKEIEEK
ETITEVTLKKPEEKISEEIIEEIKKPEAKKPVKKETSDEITVKKSIVEEKKEEEIPEQII
LKKKKPKEKPIPEEIKEEITLKKLKEKVSEEEQIEIKKPKEKKSVEKEATSEITIKKPVE
NEEEEILEEVTLKKKKPVLEEVKEEITLKKPIPKEKVPEEISEQIEIKKPKKKKPVEEEA
ADEITIKKPETVEKEEEEITEEVTLKKKKPKEKPVLEEVKEEVTLKKPIPKEKVPEEVTE
QVEIKKPKKKKPVEEEAADEITIKKPVSIEKEEEEITEEVTLKKKKPKEKPVLEEVKEEV
TLKKPIPKEKVPEEITEQVEIKKPKKKKPVEEEAADEITIKKPEPIEKEEEEIIEEVTLK
KKKPKEKSVLEEVKEEVTLKKPVPKEKVPEEITEQVEIKKPKKKKPVEEEAADEITIKKP
EPIEKEEEEIIEEVTLKKKKPKEKSVLEEVKEEVTLKKPVPKEKVPEEITEQVEIKKPKK
KKPVEEEAADEITIKKPEPIEKEEEEIIEEVTLKKKKPKEKSVLEEVKEEVTLKKPIPKE
KVPEEVTEQVEIKKPKKKKPVEEEAADEITIKKPEPVEKEEEEITEEVTLKKKKPKEKPV
LEEVKEEVTLKKPIPKEKVPEEVTEQVEIKKPKKKKPVEEEAADEITIKKPELVEKEEEE
ITEDITLKKKKPKEKPVLEEVTEEITLKKPKEKEKVLEEVTEKIEVKKSKKKKPIVEEAA
DEVTIKKIVEEETKEEEAPEEVVLRPKSKRKSIVEEEEEVTEVTITKPKPVEEEKKSKEV
EVFLKKKKPVVEEEVADVTVKKLISTEAEEVPEEFTIKKKKKPEKKPTVPEEVEETAITI
KKVRGPEERKEEGEVSTEIQIKKKKPERKVKEEATEELTIKKFEELKEPEEKEEVQEFTV
KRKPPKQPPKPIEEIYEDVTLRKLRPKRKPRPDINEVTEVENVTFRPRSTKTKEDVEQEF
KISLNTYEEEDISMSGKVRLKPKKRPMTYSEEAGEETIKIIQEIEDDSGPIIEEIIESDE
EAKDQYSIEELETDEMRLPFRKRKKKEPKPYKVEDVEEGDVKLKLKHERKYSIEEIDETL
ALKLKAKRRVSTYEEEEASLSITREEDISEGEEIEYVVRDGDTMFSICSYVAETDEAINL
VEGERVYIIDHTNQDWWFVKKHLTEEKGWVPAQYLLNEVHYTHYLQRKLHEKIDKLPVFE
KPGPGEKTSAPRFIEKLQPIHTPDGYTVQFECQVEGLPRPQITWFRQTAIIKPSPDFQMY
YDDDNVATLIIREVFPEDAGTFTCVAKNAAGFASSTTELIVEAPLSDHGSDLTGPSRKSL
SRESSLADILEGIPPTFSRKPKAKYVNEGEDVILECRLVAVPEPEITWYYKDMQITTKEN
IVVATESDMHMYCSVIKITKVQKKQEGKYTIIAKNREGEATIEIPMKVKTGKHEPPEILE
PLQSYVIREGETVVLSTQIVGNPAPKVTWYKNGKPLKDLIPKQDGHVNTLTLIQPQVSDS
GDYSVTAINDLGKVETKATLTVEINLNPSLTISFQQHAYEHYTLTKEIPSGAPEPPLFTE
RFQELTVPQKGTFKLVAKVTGNPVPEVTWLRNNKPLEKSPNIIETYDGENIVLEIRNADS
EVDAGDYKCIASNPVGKASHGAKVTVDVEKVTFTKTLEKEMIVDEYKTLELICETSHTVS
TKWWHNDKEISGMDHREIVQEGRVHKLVIKRTSPTDEGTYKCTVKNQSTSSKVTVKATKP
EFVKKLQDCEVKERDVTILEVEITSQTADVKWFKDGESLGPSKEKLEFVKDGTIRKLLIR
NTSVHDEGEYTCTLMDEKCTAEVTVIELPPEIITKMQDVTIARGERATFEIELTKGDALV
RWFKDGQELQFSEHVQLSIDGKRQRLKIYDTEPEDAGVYSCEVGQQKSSAKLIVEEPGVD
FITRLPDVTLVPLNADAVFLIEISRDVPVTWMRKSEVIKESSKYSIVDEGTIKKLIVKKC
TTKDISEYTAAVTNVKTSSKLRVEVIEVAPKINPDTPKKYKVRKGEDVEIVVKFSSTPKP
NDEWTVNGHVVTKSKRVVPSIDEESAILTIRKIQEEDVGDYTLKLVNNVGEASIEINVVI
VQVPSAPGAPEPLEITENSVTLHWKKPDSNGNSPIVEYILEHQEKTETTWTKIAETIKET
THKVTKLTTNKEYTFRVTAANEAGPGETSPTSPYIKITKPSAAEPPIILEPLKSVVVGLG
ETVSLTCVIGGTPAPEITWLRNGEIFEDINITYENRVSKYTITRTTETSSASFTVKAKND
IGTAETTCELKVQEPPKIIYDETLASQNLPVNGQWKIEIQMSGFPKPEITWLKNNKKIVD
KRVSIETVENTSTIFISSLSREDSATYTVKAVNEAGSSSVELHLRVIDKPSKPQGPVVFK
KIRQDRVTIEWRPPEDDGGIELEKYTIEKYEPGKTWTKVVDIDKEVESFCVHKLQQNAEY
KFRIIARNAVGASEPLESETVKMRTSFEPPGPPRGPLEVSGMTKTSFTIKWQAPENDGGT
PITEYIIEIKEESKKAWQKIGSTKHETTQFGVSNLKTDVPYNFRITAKNSVGTGPPYVAE
EPIAPGRRIKITKMTESTMYALLGIFPPTKIIISKTPPSSPQHVQVINVTSKSVTLSWSP
PASNGGTELTGYIIEKRPLIGKGARWTKVVTLDATTLQYCIENLKESEFIFRIFAENNMG
LSLPTNSEPVTLMTHANVPSPPTAPLEIRQIAANTVVISWGRPESDGGAPLESYKIAIRD
AKKTMWMEVGRVNADTQKLNIRDLQENHMYLIRIFAKNEVGLSDPLESDEPVKIIPASEL
AVVEPIAEMTEKGETASVSFSTENTSSWLREHNMDADIHSYARARLLRQDEYFFRIWHYA
KKLFE
NT seq 63918 nt NT seq  +upstreamnt  +downstreamnt
atgcccacgaagaatctggaggtggtggatattttagaagccctcgaatcgaagctcgcg
tacattccaggaggacgtgatcgggaaggaagacctttgatggtggtcaatgttccctca
gaacttcaaccgaccacgaagccaaggttggaagtattgatcgcctattttttgtccatt
tttagcgaggagacgaagaagaatggattggttttgatagtggacgcgagaaagggcgcg
tggagggtggcgaggtcttgcatcaggttgtctactgtacttctgggagcttctgccgca
tccgtcatcgtggtgcgccctgatggcttctgggacaaaagggtggacagttgcacgaaa
tcgcacaaggaaggagagccgacgtacctcaccctgacgaggctccagctccacgtcgac
tttgcacagctgccgtacgagctgggtggcaacaaactttacgatcacgtggattggatc
cagaagcgcgtgaaagtggaggattacaccaaggatgcatccgatctcatcactaaaatg
gcagatctgcaccgaagattgatcagtttggatggatttcgaatgtcagagtcggacgac
gatttggaatcttattgggggatgagcaacgaattaacagctcatgcacgacacattctt
caatcaggaagaaatttagtcggttcgatggccagagaatcttcgaaagatacattggac
agtacgaaaagaattcacgagcttatcgactccatcgagctgaagaagttggacatcgaa
aattcttggtcagaaatggagaagaatttggatacggcgagggtgatcggtgatctcgag
aaaggtgtgtcacgtgttacagattggatattgggaccagctgacgccatgttgaactct
tgttgccaggttggatttgacgtctcttcctcggaagagcttcgcagacgtcacgaggaa
ctcgaattagaatgcagggaaacttatggacgatacgcggaactgcttcacaagatcgac
agtttaccaagcacgcgtttatccgaggatttgaaatctcagagggatttcatggatttc
gtgtgcagaagttttgcaaacaggctcgagagacggcgaaacgtgttaatcacttcgcaa
agatttttcagactagtttccgagtactttgacaaaacgagcgaggtcttcgataaatta
gtgatgggcaacagaactcacgatttttcacaagctggagtcaatcttttgaagttgcaa
caaagccaaggaatcttggaatctttggaacgcgagttggtaaaggaaggtgaaaaatta
tcggacattttgtcgatgccagtgaaggacgcgcttggacgcgatgtgcatgttgactat
ggcgaagatatagtcaatgtcagagatattttggatgcgacgaacgccaggaagaatatt
ttcaatgacagcgtcgagctgcagaaactctccctaaagcagacagcattgatatacatt
tacgaaaacgatggcgaacaggctgtaaaatggttgaacgatttgtacaatgttttgttg
aaaaatcatatggagattggttgcaacgcgatcgagatacaatctcagaaagaggaacat
caatcctttcaagaaaccgctaagggaacgtacgactatggttgtcaattggtgaatggt
gcacgagtgttgaggttgtcgtgcagactgccgttggaaagtaacgcgagtctgttctca
aggttgagacaagcttggaaacggcttcgatccgttggccaggaacaattaacgagactg
agagtgtgcgccgtcttccacagaagcgtcgaagatgtacgcacgcattgttccaagctg
cacgacttgatagagaccgtggtatctctgcgtcgctcgttgaggctcgaggatctagca
gcggaggcgcgagccaaggccgaaataaggaacatcctgggcaatcgcgaaaagctcctc
ctcgaagtcggtcgaatggtgaggcttggccgcctgttgaggacacgcctgaaggagcca
ctgtgtcatcaacgaatgtcggaagccgaggatgcctcctcgggcaaaggcagtaacctg
acagcggtggaggcgatctcggcgaggttggcggaagtaactcgtctcgccgagaagttg
gacgcgaaactttgcgaggctggcgccaggactcgtccagtcccgatgtcctcgtccgcc
gtctcctccaccccctcccccctctcgtcctcgagcgcgccccccacttccgcctcgggt
caaatccacacgatttccgctgtcacaacttcgtcgatcgggatcacagcaccgttgatc
agctcctcgacggtgcagcttcagcccaaatgcgtgtccacgatactctcctcggcgacg
agcaacgagaacgttggcacgacgaccaaagattcggcgcagagtgtgaatggcacggga
gttggtgatgaaaaggtggagagcaaggtggaggatgagggggaggctggaacaggggaa
gagaatagacaggatgatttgagcgggatgaatgatgagaagttgaagggagaagttgtg
gaggacgtgatcgaaaagtcattcgacgataatctagccgaagattcgaacatggacgaa
tacgtaactgcgactgaatgttcaatcactccgacagttcgttcgaggagcgaatctttc
gttacgtctccagaatgggaagatctcgctgctccaacatccgtgacacatacttgttgc
gatactgggtggaacatcgaagaaactaagcttaaacggacggaaagtttggaaacggag
aaaatcgacgcttcgatggatattccaaaaccggaagtcgaggggacggagaacgaggga
aaacagagtgagaagctcgtgtcgatggaaaaaagagtcgaagagaaatccgggaagata
gtgaaagaagttacggaaacgacgactttacgagtgtctcacgatactcgtttagatatt
gcgtcttacaaggtgatatccaacaccacgcaagatcatcgagaaaacgtagatgttaag
gaaatcaaggatctcgaacgcatcgtgttgccggatgtccacgagaaaacgaatggatcg
cactacgagatggattccgttagcaaatcggagtcgtacagtcgcagagacgaattgtcc
acgaaaacggacgacatcgagcgcgtggtaaaattcgcgaagatctgcgaaataaatcaa
gaatcgcgcacgatctctgtcgatacatcggcgaaggatatcgctctgtccttgaaggaa
tacaggcgacgtcacgaggacagtgggatcgagatgtcgccgacgaagaaagacgaaaac
ctcgagggccaagatttcctcgaagcggcgaggaagagaagagttgcgagaatggtagac
gggcacgactcgatggaaacggcggagaatagcgagggtcctcgtgagaaggaatcacga
acaatggtggagagcaacgaggatggaacccaacaaaccaccagcccgaccaccaccata
agcaccatagcagtgcagagcggtgaaacgcgtctggtgatcgctctacttcaaagcgga
gaatggctgagattgaaggtcctggaggttcaaccagaactaacgaagctcggtgccacg
gtggaggaagccaccgagctctcgaatgcgcacgacgaagttctgcttcgattgcagagc
aaacagagcccggtggaggaattgctccggcaggctgatcagttgatctcgaaccaaagg
ccaagagcggaagtgtacgccgcgatggcggaaacgttgggccaagcttggcgcgatgtg
aacgagcttttggaacgtcgaaaacaaatcctcgactcgaacgtattgttccaatgtcga
gcggaggagtgtcgagagagcatgagggcattggagatggcttgtaacgacacgctgttg
ccgatcgagatcgaggcggtgaagaatttcttgtcgaaaatccacgatcttcgaaagaac
atgctcgaggcgttgatgggcgcgttgcaagaggggaagaatttattggaccggctgaag
gagattgcgaacgaaggcacattggactccaggcccgagagaattaagctcgaagctgat
cacgccgtgttgaaggttgagaaatggttggaagagctccacgataggagacggttgatc
gaggcgtcgttccgcagtagaaagacacaattggagcaatgtctggctttagctctgcta
gcgaccgatctacgcgatctcgaggagatcttgaacgataggatcgctgctctgtcgagc
agctgcgatcaactgggagattccgcgtcgagcgcggaattgctcctgttcgaattgaaa
aaattacaggctgaggctaaggaatttcaagacagatcgatcaaaataacgaaatcgacc
gaacgattagtgtcatcgggacactttgccggtgaacaggcgacagaacaagcttatgcg
atccttggcgccgcggctgattatgtcaatgatttagatcagtatgagtcgttgttgaat
agagcggtggccttctttgattcggcaagatcggcaatcacgaagctagatcaattggag
attcaactggtgaccacagagcatcccccgtattcgacgagattagctcgtttccatgcc
cagaccgtcgccaccatcgaagacgttacagcgaaacctttggcggaaggatacgccctc
ttggacatcacgggaagaggagcgcctggggctgagggtgtgaaacgggcggtggaggag
ttggagaaccggaagatccggttgatggaacggtgcacggcccacgagaaggagaatctc
gagatatcgaggatcataaacacgttcctggacaagcacgacgagctgagaaagtggtta
atgagcatacccgaagcgtttcttcagggccaccaagacatgggcagcgacgtcacaatg
gctgaggatttctgcaggcttcaccgccaactgttgaccgatctcgagcagagaaccgtc
gaggtcgagcatctcgagttcgaaattcttccgatcagggaacggctcgacgagtcgcag
aagttggaattgcaatcgaaggtagaggagttgaagaactcttggtcgaagaccaaggat
ttggtggcgggaagaatcgatttgggatccctttaccttcaattccacgtggtcgtcgag
gagttgacgaaggagatcgagtccatcgaagccgagttgaagaggcacgttgacgttttg
gacgagggaaggatcgaatcgattggaagacgttggaaggatcttcaaccactttacgtg
agattaactggtacaggaaaggcgttcttggatgctgctgtcaagatcgacgacccctat
ttggatgtgcagagggcctgcatatgcgttcagatgcttttagaaaagtttgccaataaa
cagttgaccgtgacggaatcgtgggagaaatggcgaaccacgatagagattttgagggag
aaacggatcgagcatgaacgaaaaatagaagaaagcacgaggacgatggaatgggtgtct
aaattcagcgagcaattgtatccagtgatcacgtctgtttctcatcaaacggcgaacatt
cttcaagatcttgctggatccaaagatcgtatcctccccgagttgaacaaagcagtggac
gagttggattcgaggatcaaagggttgaatgctttggcacaaaaaggcgaagtgcaaatt
gaggatgaaatcttgaagagacttcgtcagatgcacgagaatcttcgtacgaccgcgagg
gattatgaaaatcttctcgaatcgttgatctctatcttcaagaatattgaagaggtcgag
cacaaaatcgagcagctgaagagtcaagcatcgcgtgtaacgtccctgagaaaattatcc
gaagtggaagctctgttcaacgagctcgacgcgatgagatggtcaatctccgagaggcag
agtcagatcggatcgaaggtgcgagaaacgatggttaaaatcgagcggcaggaaccacga
gaggctggtgtccacgacatcgagaaattgagacgcgccttggactcgttgtccaccgat
ttcgaagtgttttggtcacagacgactaccaaaatcgaagagtatcggcgaacttacacc
tttgccgaggatctggagaggatcgacaatgagctgctggatttgaacgaacatttgaaa
aaggtggatacgaagatcggtgagaatcttcagacggcaagggccgccgcttcttcgttc
gtgcagttcgagaaaactgtcacgattttggaagagaggatcgagacttttgtgagaacg
acagaagagtcgatcaatgttctgacgcctcaaatcatcaaggatatttcctcgttgaga
gaaagatggagaaatttgaagaggaagatcgaagaaacgaggaaacgaacgaatttggcc
atagagtatttcatgctcttggaggaagccaaggaatggaatagggagggtagtaaattg
ttggtggtgatagctaggaaggcgaccacggtaaaaacccctaaagacgcgatggtgttg
cttcaagaaattgagaattatctaaaaccaggtgaagagatgcaggaaaagagaatcgaa
aaattaaaagaattgtctacgattgtttttgacacggatagattaccacaattcaacgaa
gtcgtcgtcgagaatcggcagatgttggattcctttgccgtcatttcatccgagcttcga
acgctggcccaaaatttgaaaaatgccgaagatttacaagagaaattgagaatagaaaaa
cgggaagcggatgagaaattacaagccgcaaaaatggaaatggctgccgcggaggcagcg
agggaagaagcggagaatgcgaagaaaattgccgagaaattagcagctgaaacattggaa
aaagcaacgatagaagcgaaaaggttgaaggaagagaggaagattcaaaaagtttctgct
cctccgtcgttttcggtttcggcacaaacggagaagatcgaaaccgacgaaagttacgtc
aaagaaatggtcacttcagccaccatcaaaaaagaaatacacatcttacagaagacggaa
attgagaaaagagtaccgtctcgcgaaccgagcccacaaaagaaaatcatcaccgaagaa
actcgcgaaaaatcagttgaaagaatgcacaaggaaagtgttccaccattggcaccagag
tttacgattcctttacacgacgccactgtacaggaaggagagaaattcaccttccagtgc
aatctcattggtcaaccaacaccggaagtaatatggtacaaggatggaatctcgattttg
aataatcctgattacttgaccacttacattcacggaatttgcacattgacgatcgaagaa
acttttgccgaagattctgcgaaatatacttgcaaagctttcaatatagctggatcagcg
gaaacttccgccacattgactgtcaaagaaactgcacctgaagagcaaccgagttctcca
gttttcgtgaaagagttgatggcctcagtggctttagaaaattcttctcatcaattgaac
tgcaccgtcaaaggtaatccactgccaaccgtccaatggttcaagaacgacgtgaacatc
gataattctcccgattacgttatcacttataataatggcgaggctgtattaaaattcgag
gaagttttcttagaagacaaagctacatacacttgcaaggccacgaataaattgggccaa
gcctccacttccgcttttctcgacgttgaacccgcggaattcacttcggagaaaccatat
tttgtcacacctctttcgaatgccatgggaagagcaggtcaaagggtgaaactcgaatgc
gaggcaaaagggaatcctatgcccgctttaacttggtatcacgatggaagacccgttgaa
gaaagcatgaatttgaagatacaaatggacggtggacggaccagtttggtcatctcggag
gcgttcgccaaggatgccggatgttacacggtcgtcgccaagaacgaagcgggcgaggca
acggttacttgcaacgtgtccgtgaaggggcggcttccgcacgagacgagcgactcggaa
ttcgcctgcagcgacatggagcccgtcgtgcccaagatccagatgccgttgaaggacctc
aaggttcaggagggcctctccgttcgccttgactgcgtgatcgttggacaacctgagccg
gaaggacaggtgatttggtatcacgacgatcaacctgtaaaggaatcggccgatttccag
ttgttgttccagggtgacaagtgttccttggtcattcacgaagctttcttagacgatgct
ggtgtgtacaaagtagtcgccattaattctggcggtgaagcatctagtcaatgcacatta
acagtgacaccggttactgtttcggagaaattggatagagcgcgaacagagatcgaagaa
acattcgtcgcgggttcgccgccaagattcgtcaaacttccgaccgattctctcgtagcg
gaaggcgagaccgccattttcgaatgcgcagtggttggagagccgaaaccggaactgaga
tggttctccgacagtggcgaagtcactgagaatgaacgtattctgatccagcgaaaggag
gatggaacgagcatcctgaagatttcttcggcgattcccgaggataagggaaattacgtg
gtcaaagcgttcaatgaacacggagaagcgaaagctttcgctcgactggtcatcagatcg
ttgggtgactttagaagaaaggaagaatttgtaaagatggaggagaaactgattgccccc
acgttcaaggagagattcgaggacagaagagtgatggagggtgtctccacgaaatttgag
tgcatcgtggttggaaaaccatctccaaaaattcaatggttatttaacgatcgccccgtc
cacggcaaggacttcttggtctcggtcagcggggatcgacaagtgctgacgattccagag
accggaagtacgcatgccggtacgatttcctgcgtggccgagaacgctgctggaaaagcg
atttgcagtgctcgtctagagatcggtggcaggtcagtggaggaggtgagaaaagttggg
gaaaagagggtggtcgacttagtcgaaagatcgcccgccgacgaaatgcacgcagcgagc
agcagcgagaaacacttctcctcggagaagtccgagggcgagggggagagccaggtgttg
accaagatgtcgcagaccatcaccgagtccacgaccacccacaagacgaccaagaaggag
tacatctcatctactacgtcctccaccttgtcgaaacctggacaggaacccaccagcgtg
tccgtgaagactactgtacatagcacggaacaatcgtcctcggagaatggagcgcctcct
gttgtgcagtcgtacaaagtcgaggaacacgaaaagatcattcaagaccaaccaggcgag
attcgtcaagaaaaaacagtggtggtatctcaagacgaggaagggattaaacaaagggat
gtcaaagctgcgcaaatatcgaaaccaaccagaaaatcgactgcgccgagattcgtttcg
cctctcacagggatgatcgtggatcagggcactgatattatcctcgaaggaattatcgat
ggatttcctcaaccttcaattagctggtcgaagaacgggcaagaactgaaaacgaaagat
ggaataacgatcacttacgctcataatcatgtccgtttggaactgaagaaagtaaatgtt
aaggacgcgggacgatacacttgcacggcgagcaacgaagtcggttctgctagtagcaca
gccgatcttgtcgtaaaaaaaacgatattcccgccggtatttggcagaagattgcaagct
caagttgtgaaacgtggagaacgagtgaacatggaggtagaaatcacaggaacgccggaa
cccacggttacatggttcaaggacgatgtccctatcaaagaacgtccacctgaattgagg
attaaacagcaaggaaattgttacatgctcattatcgacaaagctgaaaaagcgcatgca
ggaaaatatatggttcgagcaacaaatgccggtggtgaagcccaaagtatagcagacttt
gctgtcttcgagccaacgcctgatactatgacagaagttcataaaactgttatttacgag
aatgtgcaagacaagaaagtcactcagtccgacgaaaagaagaaagaggttccttctagc
aaacttcctccatcaacgacaattcaacagattccgccgttaaaaacgacacctattgtg
tcatccacttcgatatcggaaacgaccaaaaccgtagaaaagatagaggagccggaaagc
aggatgagtcgttcggaaacaatctcgtccacggtcgaatcacatcaatcgcaatcaaaa
tcggagcaaaagttccacatgaagctggagcacaagacgccaatcataccggagccaagg
aaggaagaaaagatggtaacgagggaagtgattcgcgaagaagtcgagaagaaaggcgcc
gagccgaaggctacagtgatcgaggagaggacgaagatcgagaacgaaaatatagaaaca
tcgacgatagccaaaaaggatgcattgagtttcttcgaatcgatgacgaaggaaacggaa
actacgcctaaaggtcccaaagagatgattaaattagtggacgatgctgatgggcacgaa
gtgaaggttggaaaattgacgaagaactacgaaagatccactacgttccaagaggtaaag
aaacctgaaccgaaacctgcggagattcaaacgacaaagaaagctgtccacgagatattc
acgaaattggagcaagggagtacagcttctcgtggaattgacaataaactgttcgatttt
ccgtacgagccgtacaagccaccttcagagatcaagaagacagtcgtggaagaaacagtt
agctcaggatcgtcatccgttcaaggatctctgataatgtcgtcaaaaatggagagcaaa
gtggaaagtaaaatggaaagcaagtcagaattattggagggttttaatttggtgccagag
cctccaccggaaattggttacatgccgaagccggaagaattaaaaaaaaaacgccctgaa
gtgtcgattaaggctaaacagctccaagaatcctttgatagaaccctgtccccgatagat
gcgcctgttggcggtgtgaagattttccccacgccttctccaaaagtggccccaatgttt
tccatgccaccatcatcctttgagctcgagaagaaagaggtagtcgaggagccttgcgtg
agaaaggaaatccacgagaaaagggactacgtgtcttcgttcagagctatgtctcctagc
agaccttggtcatcgtcgtctgacgtggaaaccagatcgcatgtatctactgatctgtca
gaatacaggtgtcactctgcagcgtcgagtcatcaagagatactcagatctacgtcgcca
agaccatcggctgacgccttggctatggagaaatcctgggcaaagaagtgtgccgagtct
agtcggaaatcgtggcctccgcaggaagagtcgaaattcaagcaagaatggcaatcccct
ggtgaagagtacaagagttcgtcgaaggagtttaggaaggaagtcgaagagacgcctgaa
ggcggtatcagaaagaccagcatggaatcgtccagcacgactgagaggcgatcctggagt
tcgaaacaggaatcgatggagaagatcgaatcgaagagagctccatcaccactaaaaacg
caaccgatcatctacaacgcggaaacaattaaagtagatcacgtggtgaacaagatggaa
gagaaatctctgtatgagaagtacactagtgagagcgacattaagaagctggaaaagtct
gaaaagttcgaagaaaaatattcgaaaaaatggacaagctcagatgatttaaaagctcct
ggtcttgtcagaagtgtggaaccacctaaaagacccgtgattcaattgtaccatcttact
ccacctagtgagcaaattattttagaacctggcccacctccggaaatcggatatattcca
gcaccagtagtcaaagagaagaagatcgagaagatagaaaagaacttggaagtatcgttg
gagcatcagccagctaagatccctccaggaggaatcagaactattcctcctgtgccgaaa
aaggaggaacctccagcgttgcctccgaaagacgtcaaaatgactccaccaccgattcca
gccaaacaacctacacctatcgaacctctggaaccatttccattcaagccttctccttca
tctgcaccgatgaagaaggtgcctcccccaccaactcctacgaaattcgtcaaaggaagt
ttcacccaggaaagcgactacgaatcggacatggacggtcacatgaaagcaaaatggagg
ccgtacgagagtgacagcgaggagccacgttacagaagagttcaagctccagtgcctaag
ccaagcagacctagatcgaccgagcctgaaccacttcctccctctaaattcgaggtgcca
ccatcgactgtaggtccacctagaccggtgatcaccaaggagcaacaggaaaaagtgtgc
aagaagactatcgccaccactgtcaagaggcaagagagagagataaaacagcagcaacaa
aagttccaagtgggtcaaccgcctgctatcgaattgaaaccaggctctccacctatctac
gtccaaccagtgaagagtccaactccaaagagtccacctgtgaaaaagccagaatctcct
aaattcaaggtgaaaacgttccaacaggaaagtggttacatggcagacacggatgagcct
ttccaacagaagtcatcgattcaatcagtgcagaaaagttttggcaaacacgaatcttca
tcatccatgacctcgcacacggaatctcgcacatcgtattcggaaagtcgatcggaatat
ttcgagagcaaaagttacgacagccgacaacagcaacaacagaagaaagaatcgttcatc
gcgccacccgctcccttgattacgaaacaacccgtacaaccaccggttcaacaacaacgt
agttcgttcgttgagaagagctacatatcttccacgtctccatcgagattcagttccacg
aaggaaactatttataccacggatcaatcgcacaagaagttagagacaacgaaaaaaatt
ctgccgccctctccgagtccttccaaattcgtgaagggcgaatttcgcgaaagcgactac
gagagcgactacgacggcagaataccacccctttggaaaccgcgaggctatgaaagcgac
gaccaatctttcagatccgtgaaaccgaatctcgctggtccaggaaagcccaaggagcct
cgagcgccattcatcgaggagctcgagaagaagaaggaggacagggtcgcaaccccgacc
aaaccgaaaacagttcttcttcccggctctccgccggagatagcctatgcaccccctcaa
ccgacctactacgaggctcgatcgggcatacctttccacaacgcgatcggtacagagacg
aagaagacagtgaggatggacgagtcgaccgagaacagcagaaggatcgtcactgtcgag
caaacgagtcgggtgatcaagttcggcgatcagaaacccaccgccaccgacttcacaggc
ttcgagggctccgatcagaggcagaaggcggcgttcaaggtgccgaccccgaagaagttc
gttcaaggtcagttcagggaatcggattacgagagcgacatcgacacgaggatcagggcg
aaatgggctccgcccgagagcgacaccgaggagccaaggtacaggaaggtccaagcgccc
acgacgaaagcgccaaggtcggccagcgcccctgtcagacaggaacacgtggtgtccccg
ttggagtttgacaccgggccacccgtgttgaagaggcagacctcgatgacccaacttcgg
gacgagggcagggcaactcaggtgaagagggatgtttgctcggggcaggaggaagtgctg
aagcccggctcgcctcccgaattcggttttatctcgaggagcgatgtgaagaaagcggct
actcacgtcgcgtcgcgacacatgagcgacatgacaaccagcttcaagtcgaaaaccgag
aaattcgtcagcgacatccagtcagatctgaagcaaggcaagccgatcctgaaacatccg
gccgacagtcgagcaagcgatggcgacgagcccagaacttacagagaggagtctcgacac
tcggaacatggaacgaagcacatcgatccagacaccggcctcatatacttcaagtacgac
ttcggctacgagttcgggattgtgctccccggcgagggcaagagaacagtgaccagcacg
aacaggaccatccaaggtcaacgacgagcaagcgacatcgaggtgcccatcgtccacgag
ttcaccacaaccagaagggagaacggtttcgcgaagaggagcagctcgacgtcatcctcg
acgcgtcagggcaaaccgaccgggaaattcggcacttcaaagaccgtgaaatgggagccg
acatccgagagcgagttctccgaggcggaggacgtgagaaacgcgagaaagaggcagcaa
gatggcggtagcgcaatggcgccacctagcctcgttataccctgttcaccatcgccgtcc
agatgggaccacacgacgcccagtccactttccctgagcccaagcttaccaagtctctcc
cccagatacagtagtgccacgggaccacctagcaacgtcgattccgcaggatcaccgtgg
ccaaccactaatggagtggcctcgagcaaagaagtgattcagccttacctagaaatacta
ccgaaaaaggcaccccttttcatcacgcctttaaaagatatagcggtggtgagcggacaa
acagcaagattcgagtgcatcgttcaagctgaacctcagcccaacatcctttggtccaag
gacgggaggattattgagaattcttcgtgctacgagatccattatcgaaatggcgtttgt
cgtctgaccatagtgcgagcttttcctgaggatgctggcacttacgcgtgcaccgcaacg
aatagcttaggttcgacagtaacttctgccactttgcaggtgccaggagtaccttcgcca
ttttatggaacgtacagggaccaaaacatcaacgagagggctatggagagcccgcccagg
tacgtggctctcaaagacctatttcttccgcaagagaacgacgtgaaatcgatacctgcg
gatcgtcaacattctacgcgacacgattactcggtcccgtggaatttgaacgcggatccc
agttgcgcaggtggcggctatcgcgagaggcgaattacgacggaagaatgcgaggagata
acggatcgaaatacgatagcgcggcgactcgggtattccgatttcgaggcgaacgattcg
tttcgcgatgatttctgcttcgatcgcgagtattgccgctccgcgaggccgaggacggag
gacggagttcaaggggagattgtgatgcagacgacgcccaccgtaccaacatttaccggc
agaccaggcgatccatcgccgccggtcttcgaacagatattcaaaaacgccagattcgcg
cagggtggaaacgcaattttcgaaggccgcgtgagaggaaatccaaaacctatcgtctgt
tggacgcacaagggtgcaccgttgttggagtcatggaagattcacatgtcttacgacgag
aagaccggggccgtcacgcttcaaatcaaccagattggccctggagacgagggtgaatac
acgtgcagtgccaaaaatcaatacggcgaagcaatctgctccgtttacattcaaccagaa
ggatttggacctcctccgcaacagcaaatgggtggttacaggaaggaattcgcgcagact
ttccaatccaccgaacagaagacccaaacgggaacacagagctttcaacaacgtagctat
caacaaacaatcgataaacgaagctacgttaatggaacttccgtcagcatcgaagatttc
aaggtggacacgttcgaatacagattattgcgggaaacagagtttcgagagtcgatcact
cgccgcttcgtgggcgaatccgacgtgcaaatttcgacggtggtagatcgtaacctggga
ccggttgcacctccgcaaatcacgcagaagcccagaaactcgaagctcgtcgagggatcc
gacgccgttttcactgcgaaaatctctggcaatcctaaaccgagattaacttggttcaaa
aacggccagaggatccgcgaatcgcaacgcgtggagatgagctattcgaatcaacaagcc
tctttgaggatcagagtcgccctgcctgaagacagtggccattacaccttgctctcggaa
aatcctcaagggtgcaccgtcagttctgcatatttggctatcgaatcgagcgatcaggtg
gatcaagcttatcaggcccaaagagagacgatcaaaactcagcaagttgaaacgatcggc
gaaaccgattctggaaaagttctgccgccgaatttcgttcgcacctgtaccgaccgtgac
gccaccgaaggaaaaatgaccaggtttgattgtcgagtaacgggccgcccgtaccccgaa
gtgacatggtacataaacggccaacaagtggccaatgatctgacccacaagatcctcgtg
aacgagtctggtaacaactctttgatgatcacgaatgtgagccgagcggacgccggagtc
gtgacctgcgtcgcaaggaacaaggctggcgaaacctcgtttcagtgcaatttgaacgtg
atcgagaaggagcaagtggtcgcgccaaaattcgtggaacgattcacgaccacgaacgtg
aaagaaggagaaccggttgttttcatggcccgtgcggttggcactcctgtacctcgtatc
acctggcaaaaggatggagtgccgattacacctggaccggatgtgcgtatatcaacggat
ggcagcggagcttcgactttggatataccttacgcaaaattatcggatgcagcttggtac
cagtgcacggcgcagaatgtggccggctctactgcgaccagagcgcggcttttcgtggaa
acaccgaaaggagcagcccccgaaccaagacgcctgaacttaccccgaccgacgaaagtc
atcgaaccagaaccagcgcctggccccgaagtgatttatttgagacacgtggaacgcgcc
aagccatacttgcctccacccgaggaggacagaatttatccaccgccgcgtttcatcata
ccattgaaggacgtccatcagatcgagggtggacgaatccacttcgaggccagaatcgaa
ccggtgggtgatcccactatgagggtagagtggtacgtcaatggaagagctcttgacgcg
agttcccgggcgacttctatctttcgatttggcttcatctctctcgacttaattagcatc
gttctccaagacagcggcgaatatttatgccgcgtcgtaagttcgactggagtcgctgaa
tctcgagctaccctcagcgtgacaccacgcgcaacaatcgaacagactagccaacacccc
gacagtctccagtacatccaacagctcgaggattacagcaagtatcaaaggcaggagagt
gtggaggacatctctccacagcggccggtcttcatccggccactccaggatctaggagag
ttgcaggaaggtcgtaacgctcatttcgaagcgcaactgacccctgtaagcgatcccacg
atgaaagtggagtggttcaaggatggtagaccgatcacagctagctcaagaatcacaacc
atcttcaacttcggatacgtctcgctcaatatattgcacctacgagctgaagatgcgggt
tcttacactgtcagagctgtgaaccgcttgggagaggctgtcagctccgcatctcttcgt
gtctttgcacgcacaagcgttacaacagatctgggaatccccgagcaacagaggtacatc
gaggctgccgaggagttggaagcctatcaacaggctatgcaccagaaatacgtgcaggag
cagcctgaaccgacaagcccaccggaattcaaatctcctatcaaggatcagaacagcata
cgagaaggaggattcgctcatttcgaagcacgtctggaaccagttggcgattccgacttg
agagtcgagtggctcaaggacggacgccctgtagaagcgagttcaaggatcacgacattc
ttcaacttcggttacgtagcacttaccatcaaatacgtaacgattcacgacgtcggtatt
tacacgtgtcgcgcttacaaccgcgtcggtgaagcacacacaaccgcccagttgagcgtg
ataagcaagaacgatgttatttacgacagtcaacatccgactggattgcagaagatccaa
acgttggaagattcgagcagatattcgcggcagctccaagaggagacgcaagtgacacag
gcgccgcgattcttgggcaccctgaagggcacgaacaagatcgtcgaggggcaacgcgcc
cacttcgaggcccgcgtcgaacctcagagcgacttgaccatggccatcgaatggtaccac
aacggaaaaccgatcaccgcggccaatagaattcaaacttatcacgattttggatacgtg
gctatagatattcttcaagtgagatcagaggacgctggcacttacactgtcgtcgctaga
aactctcttggagaggctcgattatcggccaccatggttgtagaaactcgttcaagcgtc
gatacgagcagcatgcaccgcacttcctacgagaaaacgcaacgtttggaggagtcgaaa
ttcgtcgagccccaatatcacatcgaggagatatcgaaatcgaagccgattttcgtccaa
ccgttgagcgatcctaagccggtgagcgagggaaagaacatccatttggagtgccgtttg
gaaccgatgggcgatccaacaatgagggtcgaatggttccaaaatggccgcccggtcacc
gttggctccagattcaggacttactacgacttcggtttcgtcgctttggacatcgtgcat
tcgacagtgctcgactctggggaatacaccgtcagagccaccaatcatcttggcaccgct
cacacttccgcctgcgtcagagtgataggaaagtcagacgtcgtcacggaaacgcagcac
gaacagtccctcgagcagattcaaatgctcgaggattcgtcaagatatcgcaagacccaa
caagaagaagtgacggtgatgcaggcaccccaattcactcgccccctgcacaacatcgaa
acggtggagctcaccaacgtgcatctcgagtgtcgtctccaacctgtcggcgactcgaca
atgagagtggaatggttcgtgaatgggaggccggtgaagacgggccacagattcagaccg
tcctacgaattcgactacgtcgccctcgacatcctgggcgtctatccggaagattcaggc
gtgtacacctgccaagcgaggaaccaattgggggaggcagtcacatcctgttcagtgaga
gtacacgcgaagaaagatttgctcttggagtcccaacatcccgagggtttggagagaata
caatacttggaggatgcttccagatacaagaggcaggagatggtcgacgaggttgtcacc
gttaaaccgagattcatcacggctccgaaaagtcaagagaatctccgcgaaggggaacac
gcccacttcgagtgcaaattggaaccagtgacggactcgaatttgaaagttgaatggttt
aaaaatggtcgtccggttacgataggacaccgattccgtccaatacacgatttcggctac
gttgctctggacgtgattgacctgatcgccgaggactcgggcacctacacttgtcgcgct
gtcaatctggtcggcagcgacgaagtatcctgcactctaacctgtcgatcaactgcacag
gttctaaccgattcgaaaaacgagattggcctcgagcaaattcattatcttgaggacaga
tccagatatcaacgacgagaggacgttgaagagacgaccacccaagcccctatcttcacc
acttctttgaacaacgtcgagatcaaggaagggcaaagggcgcatttcgagtgcaggttg
attccggtttccgacgcaacgatgaaagtcgaatggttccacaacaataaaccggtcaag
gccggctccagattcgtcgagacaaatagctttggcttcgtggcgttggatatcatgtac
gcctatcctgaagattccggcacgtacacctgcagagcaaagaatattataggagaggct
atcacgtcggcaagcgcagttgtacactcgaaaaaatcaatctacaccgagtcccaaaac
gaggagactcttcaaagactgcattatttggaggatacctcgcgataccaacgcaaaacc
acaactgaagagatcattactcaagctccagtattcacgatgcccatcaaggacctgaaa
gttgctgaaaatcaagcggctcatttcgaggctcgtgtaatccctgtcggtgattccaag
ctgaaagtagaatggcttcgaaatggagttccgattgcagcttctaatcgtgtaacaacg
atgcacgatttcggatacgtcgctttgaacatgaagtacgttaatcctgaagactcaggt
acttatacttgccgtgcagtgaacgatcttggagaggcagtaacatcagcaacgctcttc
gttcaatccaaggcggccctgcaattcgagtcgcagcacgagagcgctttgtcgaagatc
caggcgctggaggacacaagtaaataccaacggcgggaggaagaggagatcgtggttaag
gagaggccatcgttcacggtccaactgaacgggcccaccgctcttgtcgagggtcaaagt
gcacattatgagtgccgcatcgagccctaccccgacccaaccatgaaggtggaatggttc
cataacgggaaaccattgtccaccggtcacaggtacagaaccacttgtgactttgggttc
gccgcgttggacgtgctcacggtatacgcggaggattctggcacctacacctgccaggca
accaatagactgggatcggcgaagagctcgatcaatctcgatgtgaaatctcgctcctcg
attattcgcgaaacgcaacacgaaagcgccttgaagaaaatacaataccttgaagacgac
tcgcgttacaaacgggtagaagaagaggatctgatcgtcgccgagagaccgaaattcgga
cggccattgaagaacatagaacatttgcccgaggggaagagcgctcacctcgaggcaacg
ctgacgcctgtcaatgatccaactatggtggtggaatggtttagggatgggagacctatt
cctcaaggacacaagttcaagactacatatgactttggatacgtcgctctcgatattctt
tacgcttatccggaagattctggaacttacatgtgcaaggcaagaaacgctgttggggag
gctgttaccacttgcgtcatcagcgtcgattcgaaacaaggcctatatttggacacgctt
gacgctcagcgtttacagaagattcgcgagttagaaaccgtggaggtgaagcaagaagtt
gagaaagaggttgtacaccaaaaacctgtgttcttgacaccattgaacaatctggatcat
ctaaaggagggtgaacacgctcatttggaatgccgcgtcgagcctatcaacgatccaaat
ctaaaaatagaatggttcgtgaatggagttgctgtaaagacaggacatcgctttcgcaaa
acacacgattttggttatgtggctctcgatattctttacacttatcctgaagatgccggc
acttatatgtgcaaggccacaaatttggctggcgaggctgttaacacatgcaccatcaaa
attggctctcgccgtagcatacttctagatacgcaacatccagatggccttgaaaagatt
cgtgaactcgaggcccaaggtcgtccagcccgtttagaggtcgaagaacctccagtgacg
ccaccgagatttgttacagaactcagaggtaccactgaagtctacgaaggacaaacagcc
catttcgagtgccaagttgaacctcttcacgatgccaacttgagaattgagttcttccac
aatggcaagccgcttccatcagcttccaggttccacgtgacgtttgatttcggatacgtg
gctctggatatcggccatgctgtccctgaagatgcaggagaatactccgtacgagcgatc
aatgctctaggccaatgcgtatcctcgatcgagctgagggtaattccaagagataatatt
attctcgactcgcaacggcccgaaggaatggacaagatccgcgaattggaagctcagcaa
ccttggaaaagaccagaagtgccagaaccgcaaaccaggcagagacctgtgttcactcaa
ccgttgcagaacatcgatgccattcccgaaggacatacagctcacttcgaatgcagattg
attcctgttggagatcccacattgaaggttgaatggttcagaaatgaaattcctcttgag
acaagttcacgaataaccaaagttcacgatttcggatacgtgtcgttggatattactcat
gttagagaggaagatgaaggtgtctacatgtgtcgtgctaccaatccacttggtgaagca
gttacaactgcttcgatgaagatcagaagtaaagcaagtattcaattagatacccaacat
cccgaagcgcaacgtaagatcgcccaacttgaagccgacaaaggaccgagtcgcactgaa
gagccagaaaaagtattcgacaaacccatcttcacgcaattattgactggacccacagaa
ttgtgggaaggtcaaacggctagatatgaatgcagagtcgttccagttggtgatgccagt
ttaagattcgagtggtacataaatggtgtcgaactaaaaatgggatctcggttccacgta
agccacgatttcggctacgtaaccttagatattctaaaagtaatcacggaggattcaggt
gtgtacacctgcaaagcgattaacaaagccggtgaagcggtttcctcgatatccttgaaa
gtgaaagcgcgctcggccatcgatgctgaaagtttgcaaccagatgcgtggcaaaagatc
caactgaaagaggcagagatgaacaaagtgccggaaatgttcgtggacacgacgcctcaa
caagcaccagtattcaccaaacatctagaaagctacgataaactcgtggagggtcaacat
gtatacttagaggctcaggtagaaccaagagcagatccaaatctgcgcgtagaatggttc
aaaaacgggattgctcttcaaactggaaccagacttcgcagtaccttcgactttggtctc
gtcacgttatccatcaatggcctcagatccgacgattccgccatctacacttgtaaagcc
accaatcttctcggtgaagctgtgtccacctgcagcctgaagatcgtcgatcgccattgg
ttgcttggagatactcttcatcctgatgcacttccaaagattgatgctttggaacaacct
catgtcaccacagtagagcaaccagagccaatatacgaagttccagtattcatcactcat
ttaaacaacgtcgaatgcgtggaaggtgacaatgcgcacttcgagtgtaacgtggaaccg
tccaaagatccaacgatgaagatcgaatggttcatcaatggaaaaccgcttccaactgga
gcaagattcaaatcgacttatgattttggatatgtagctttggaccttacccacgcttac
gaggaggactcgggagtggtgatcgtcaaggctacgaattcgaagggatcggctcaaaca
tcaggcactttgaaatgcactagcaagcagagcatctatctacagactcagcatccccaa
ggagaggctggactggagaaggtgaaagaagtggaagacgcttatctgtccaaattgaaa
agaccggatgctggaccggaacaagaatatccgaaacctgtgtggacagtgcctctgcag
ccggagttcaaactgggcgaatctgaacctcttcatctggaaggtcaagttgagcccaag
gatgatccaaatttgaagatcgagtggtatttcaatggaaaggctctggagcatgggtcc
agattcaagatgaccagtgactttggtttcgttacattggatttgaccgatgtatacgac
cgtgattctggaatttacacctgcaaggcctacaataaagcgggagaggccttcacttcg
accacgatctattgctcgactaaggagaacatcattgagaaatcccaacatccaaaaggc
aaggaaggtctcgaagccattcaagatttagaagaatcattgaaacgacaagaaggagct
ccaccggagagcgaggaaggtcatccacctgtgttcacatctcaattcgagaacctgacc
aatctatctgaaggggagatagctcacttcgaggcatctcttacgccaactggtgatcaa
acaatggtagtcgagtggttctacaatggaaaatcattagaggccagtcatcgcacgaga
acggtttacgcctttggcatggtcgttcttgaagttcttggaaccaagatagaggactct
ggcacctactcctgcagggctaccaacaaatggggccaggctgagatcagcgtgcaattg
gaatgcgtggacaaatctaaaggacagaaaccaaaattcactacccatattcagtctctg
gagggtttgaaggatggtcaatcggcgcactttgagtgcactctgatcccagtcggagat
cctcatatgaaggtcgaatggttccacaacggacaacctctgagacactcatccaggttc
aagatggtgtccgactttggattcgtcgtgatggacattgctggcgtgatggctcacgac
actggagagtacgtgtgcaaggcaagcaacaaattcggcgaagattataccaaagctacg
ttgaaatgctttggaaagagcggagtgtacctcgactcattgcaacccgattctttagcc
agaatcagggaattggagagttacggtggtgaacaacctaccacgccaacgacaccagtg
gcagaaccacctaaattcatcacgcaaatctctgatattacgaaattagtcgaaggacaa
tccgctcacttcgaggccagacttacacccgtcaatgacccagacttgaaagtcgaatgg
tactacaatggaaagaaactgcctcatggacatagatatagaaccttccacgattttggt
atcgttatcttggatatattgtattgttacgaggaaaattctggagtctacgaatgtaga
gctttcaacaaatacggcgaggacacgactaaggcaactttgaaatgttactccaagtca
agtctcattttggaatctcaacttcccaagggaatggaaggcggattggagaagatccag
actttggaggattcgatgattcgtacaagagacgaaaaagtcgtcgaggaaagaggaaag
gctcctgtcttcaccgtacccttgagcaatatcgatggccttcgcgagggagagagcgcg
cactttgaagctagacttacacccactgacgatccaaaactaaaggtcgaatggttctgg
aacggtaaaccgctacgaacaggtactcgtttccgcaccttctgcgacttcggcttcgtg
atcctcgaaatctcgcccatctatccagaggactctggcgagtacagttgccgagcaaca
aacgattacggcgaagcagtgaccacctgtaccatgaaatgcacagggaaacgaagcatt
atcctcgaatcccaattgccaaaaggaatggagggcaccatcgacaagatagctgagcta
gaaggtcttggaaacgaaccaggcgaagtgatcccagacgacgatacggggaaaccaccg
gaattcatcacaactccgtccgacttaacgctaactgagaattccttggcgcatttcgag
tgtagattgacacccatcaacgactctagcatgagggtggaatggttccacaatggaaaa
cctcttctagctggaaccaggatcaagactatccacgactttggtttcgtcatcctagaa
gtggccaattgttaccaacgcgattcaggcctgtacacgtgcaaagcgaccaaccgccat
ggcgaagcaacggtgtcgtgcaaacttcaagtccgtggacgacaaggaatcatcttggaa
ccccagctgcctaccaatttcaagaccggaacagagagtatccaaaagttggaagaggct
ttgtacaagaaggatgagatattgaccgaagaagagacgcccaatcctcccaagtttact
gtcgaattaaaggatatcgaggtagaagaaggcgcacccagtcatttcgattgcagagtc
gaacctgtcggcgattctacgatgcgcatcgattggttccacaatggaagatcatttgct
actggatctcgcgtccaccagataaacgactttggttttatctcgttagatatgtcgtat
acttatgccagggacagcggcgaatatatttgcagagctaccaataagtggggttctgct
actactaaagctaccataacttgtaaatctaagaaaaccatagatttcgactcgcagctg
ccttcaggcatgagtggcgagaaactgaaggaactagaacgtggtccagtcagcgaacca
ccgcctgctgaagaaccaccacgtcaaccaccgaaattcatcacgcatattcaatcagca
acagtggacgaatcggaagcggtcaggttcgagtgtcgcgtggaaccgaaggacgatccg
aatctgcgtatcgaatggtacagaaatggaaaattgatcccagctggacacagatacaga
acgatgtatgacatgggattcgtgtctatggatatcttatatgtttatcctgaagactca
ggagaatatgtgtgcaaagctatcaatgatctcggagaagacaccactagggcatcagta
tcgtgcaaaaagttgcccaacatcattctacagaaccaagtgccaaaaggtatgaaaaag
tcggaagcgttgatgcagatggaagcaactatcaagaaatacacctcagaagtccatctt
acggaggatgatctttatgacgcggacaagaaacaaccgcctcgtttcgtcacccagatc
caagatcaaaccgagctggtcgagatgaacagcactaaattcgaatgtcaattggctcct
gttggcgatccaaacatgaaagtcgaatggttcttcaatggcaaacctttaccgcacaag
aacagatttacccctatttacgactttggttatgtggccatgaacttcggctgggtctat
cctgaagacagcggcgaatacctttgcagggccacgaatctttatggaatggacgagaca
cgggcggtgattcgaacggctggcaagcctggaattatttacgagtcccaattaccgaag
ggcatgaagagtatcgaaaagatcagagaaatggaagctgcatggcaaatagtacctgag
gaagaaggtgaagaagagaaggtgagggcgcccccaacatttgtgagcaaaccagaacca
gtaaccgtcgaagagggcgattggtccagattctgctgtcgtgtcactggtcatccaaga
ccccgtgtcatgtggatcatcaatggacatactgtggtcaatggatcacgttataaactg
acttatgacggcatgtaccacctggacatcccgaaaacgaggcaatacgatcacggaaaa
gtggaagtgatcgcgagaagctcagtaggcgaggcacgtactgaaaccacattgacagtg
aaaccacgaagcgacgattatcgtggcgtgttgaagaactcgccaagaccttggtatgat
tacgggctgacccaataccaaacggagcgacagaacacagagctcgagagagttttcgac
gagaggcatcacaatatctctcagggcatcgagatcgccaccgaacaccttggacagaag
gtctacaaggaaccagagaccgaatggcaaaagtctgtgaagagtaagaaaaacgaggac
tattacaacaaactgatgaccctcgaggaggagcaagtcttaaaggagagtagattgaga
gaatccagccaccagttcgccattcctggcgaaaaagttgtcgcccattctgtggcgaag
ggaatggcccaacaatacgaggagacgctggaagacaagaaggacgagaagattcaggag
acccaacagacaactacgaaattcgtgaagaagccacacacgacggaagtggacatcgat
atggagcgcgtgaaaggaaggtatcctccagagccgtcggaatccacagtgcacgggcgc
gaagtgcacgtagctaaacaaaagcagatccagaaagaggtcaaaggagatctggagatc
accagaaagataacggccacggaaacgaccgaggtggagcacaaagcgaaaactcaggag
cgcatcgttcaaggtccaacgaaacctgccaaacctcctgtgttcacgaagaagattcaa
ccttgcagagcgtttgagcaggaacaagcacgattcgaggtcgaattcgacggtgatcca
ttgccgtccatcaaatggtaccgcgaggatttccccatacaaaattctccggatcttcag
atttacacattcagcacgaaatcagtgttgatcattcgccaagtttttatggaggattcc
ggtgtgttctccgtgatcgctgagaatcgcggtgggaaggcgaaatgcagcgcgaatttg
gtagtcgaggagcgtagaaggcaaccgggcagaggtggagtggtgccacctagcttcctg
tccaccattcaaagcacctccgtcaccactggccaactggctagatttgatgccaaagtg
accggaaccaagcctttagatgtttattggttgaagaacggcaagaaagtgacggcagac
attcgttacaagacactcgaagaggacaacacttacactctgttgattctggaaaccata
ccagaagattcaggcaaatacgaatgcgttgcaataaacagcgctggagaagcgcgttgc
gatgccgactgcatggtccgtggccctcaatctcccgccaaaactgcgaaaccaacgaca
cctggcgtcgagaaggcgccgcaagtgttggagccgttgaaagatcaaactatcagagag
ggtacgtccgtcgcattcgcgtgtaggatcactggaaaaccagtacccacggtgcaatgg
aagaaaggcgacaaggttatcaaaccatctaaatatttccaaatgcagaaagatggtgac
ctctgcactctgaggatttctgaggcattccctgaagatgagggagtttataaatgcatt
gccaaaaatccagctggtgatgtcaccacctcagcaaacctcagagttcttgcccctgat
gcaactgatgttcttcccaaattgtcaccactgaaagatcaaatagtgtttgaaggacaa
ccggcacaattcaagactcaagttactccagctaaaccaaagccaacgatccaatggtat
cgcgaaggtgccctaattcctcagtcaccagatttccagatgattcacgaaggtaacaac
gccgtgttgctgatagcaaccacgtacgaagaagacactggcactttcacctgccgggct
accacatcagccggtaccgtagaaacatctgccaaactcatcgtaaaaaagaggaaagga
gcgtattacgaggttcctactgagacgggaccaggtgtaaaatcatcgacaaattatgga
agagatattatcctagagccattgactctagacgagaatggattgccactcgaaagttta
cccttgcaatctggtgatgaatcgttaccttggagaaagggacgggttcatcatcgacct
cgacttggcgacgtgacgccatggaggaaatcaaaatctcgcgacacatctttagacaaa
ttgcaggccgtggaaggccaagtgaaaccttggacagaggaagcggtagtgttgaagaaa
actccacaagtgcctcgtgaaatgccgagggaaaaattggaggaagtcgagttgaaacca
acaaaaattgagaagaaagatattgcaagagctagtctcgaagcggttgatctgaaacct
gttcttagagaaatgacaaaagaaataaaaactgaagaagagaagatcactcaactggat
aagactacggaagaaatttacgtggaagaagaggactctagatttgtcaaaacctcgaaa
agaatagatgaaactgttcaaaggaaaaaggaagaagttaaaccttggaccgaagagaag
gttacgttaaagaaatcgaaacttgataggaaggagattcctagagagactttagagact
gtggaattgaaaccttcaaagattgttaagaaggaagtcgataaagctactttggaaaag
gtggatttgaaatctattcctatagtgactgagaagattactgaggaaacgatttcgaag
agtgaatatcttgaacaagaagacacatcgatgttagatgtgactaagattgaagaagtg
aaaaaattaaagaaagagaagatagaagaaaaaatggaacaaacgaaaccttggaccgaa
gagaagatcactttgaaaaaatctaaaccagaaaagaaagaaattgagaaaaaaactata
gaaattgtggaattaaaaccatcgaagattgaaaaattacctgatcgaaaatcaagttta
gagaaagtggacttaaaacctgttccaacagcagtgactgagaaaatcaccgagaaaaaa
atcattgaaaaaactaaatattttgaagaagaggatactgctttgttagaggtatcaaag
actgaagaactgaagaaaatgaagaaagacaaggttgaagagaaaccggaagagaagcct
aaactttggactgaagaaaaagttacattgaagaagactaagcctgtgaaaaaagaagtt
gaaaaggaaacaatagaaacagttgaattgaaaccatcgaaaataacaaaaacttcaatt
cgaaaagaaagtttagaaacagtggatcttaaaactgtcaaaaaggaaagagagaaaacg
atgaaagaaatcgtgcaaaagactgattatatagaacaagaagacacgacattgcttgat
atttccaaggatacgcaagtgaagaaaacaaggaaagaatcgatctcagtagaaaaggaa
catgctaaaccttggacagaagagaaaataacattgaaaaaagccaaacctgaaaagaaa
gaaatatcaaaagaaacgttcgagactgtacaattaaaaccatctaagccagaaaaggca
gatatagaaaaatcgagtctcgaagagatagatttgaaacctattcctaagaaagaaatt
cctaaaaaacctgaagaaaaagaggtggttgttgaaaaagatgacacaactcttcttcag
gtcgccaaggataccgaaactactgtcaagatcgacaaaaaagtgaagaaaaaggaagaa
acagaaagaaaaacttcggaaactaaaccttggactgaagaaaaaataactttgaagaaa
gctaaagtcgagcaaaaagaagttcgaagggaaagtttggaagaagtgattttgaaacca
actaaaacagaaaaaagagaaataaagaaagaaacattggagaaagtagatttgcaaaaa
gtaactgacaagactcaattcgtagagaaagaagatacaaaagtcttgaaaatagacaga
gaagaaaaaatcgaagaagacaaaatagagaaagtagcgacttggagaaaagaaaggaaa
ctgaaggaaccatatcacgaggaagaggataaaacgatattggacgtagagaaagatatc
gaattcatggagaagcagaaggaaatgccagtaccttgggtcagaggcaagaagaagctc
acagaaaaagttccttatcacaaagaagaggatactactctccttgatattgaaaagact
gaaaagacgactgagaaacagatgaaagaggaagtgccgattccatgggcacgaggaaag
aaagcaaagaaagaaaaatcagatgttccacagaaagtggaagaaaagccagtagaggaa
gaagaaaaattggagacaatgcaagttccatggcttcgagataagaagatgacaaagaaa
ataccagaaaagaaagaggaactggctgatgatatcaaatctgtcacattgaaaccagtc
aggcgcgaacatgtgccggaagagaaggagaaattagaagaggtaacattgaagcctgtc
aaacgcattccacgtgaagaagaagagaaggaggaagtgcaattgaaacccattccgaaa
cgcaagtctgaagagaaaccacgtgaagaagtgacgttgaaatcattccaaaaaccgaaa
caggaagaagagaaatcgaagaaaccagaattgaaaccactcgagaaatctaaacctgaa
gcaccagaaaaggaaaaagtacagttaaaaccattccaacgagaaaaaccggaagaaaaa
ctaactataatctcacaaaaacttccggaaaaaacacaagaaaaagaaataaaggaagtt
gaagaaatatcatggcgcaggaaaccaaagaaaccgtcgatttctgaagaatcacctgtt
gaaaaagtagcagaaaaaattgtggaggaaaaagtaatcaaaaaagaagaagaaacgatc
gaagatttcaaatcaatagctttgaaaccaattaaacgagagaaaaaacctgaagaacgg
gaagataaggaggaaattatattgaaaccagtgaaacatattaagaaagaggaagaaagc
actgaggaaattaaattgaaaccggtagagaaaccagagaagaagatagaagagaaagaa
gagaaacctttgaaattgatcgaagaagaaaaaccaattgaatcagaattgccttggcga
cgtgacaaaaagaaatctatcgaacaaaaagttactgaaatcccaattgaagagaaaaaa
gtagaagaagaacaagtggaagttagttggcgaaaaccacgggagaaagttatgaaggaa
gtacaaaaagaaaaagtggaagatttcacagcaattaaattgaaaccagcaagaaaagaa
aaaagaccagatgaaaagatagaaaaggaagaagtagtattgaaaccgattgagaaaata
ccaaaagaggaagaaataattgaagaagtgacacttaaatcagaaaaattggagaaacca
gaaacattcgaaaatggtgaaattcttgaagaaaagactgaattgccatggcgacgtggt
aaaaagaaattagcaaaggaagaagtgaaacttgaacaaatactaaaacttgaaaaacaa
gtatctaaaagtgtcgaagaacaaataatatttaaacataaagatgagaaacctgaggaa
aaagaaatatcagagattaaattaaaaccagttaaacacatagaaaaaccaaaagaagaa
aagcctgaagaagtaaaattgaaacctgtaaagcgacttccaaaggaagaagaggaaaaa
gaagtggtaacattgaaaccaataaaaaaagaaaaaccagaagaggaaaaaccagaactt
aaactgaaacccgtaaaacatatagaaaaaccagaagaagagaaacctgaagaagtgaaa
ttgaaacctgtgaaacgtcttcctaaggaagaagaggaaaaagaaatggtaacactaaaa
ccagtaaagaaagaaaagccggaagaagagaaacctgaagaagtaaaactgaaaccaaca
aagaaagaaaaaccagaggaagagaaacccgaggaagtgaaattgaaacccgtgaaacgt
cttcctaaggaagaagaggaaaaagaagtggtaacactaaaaccaataaagaaagaaaaa
ccggaagaagagaaacctgaggaagtgaaattgaaacctgtgaaacgtcttcctaaggaa
gaagaggaaaaagaagtggtaacactaaaaccagtaaagaaagaaaagccagaagaagag
aaacccgaggaagtgaaattgaaacctgtgaaacgtcttcctaaggaagaagaggaaaaa
gaagtggtaactttgaaaccaataaagaaagaaaaaccagaggaagagaaacccgaggaa
gtgaaattgaaacctgtgaaacgtcttcctaaggaagaagaggaaaaagaagtggtaact
ctgaaaccaataaagaaagaaaaaccagaggaagagaaacccgaggaagtgaaattgaaa
cctgtgaaacgtcttcctaaggaagaagaggaaaaagaagtggtaactctgaaaccaata
aagaaagaaaaaccagaggaagaaaaacctgaagaagtaaaattgaaacctgtgcaacgt
ttgccaaaagaagaagaagaaaaagaggaagtaattttgaaaccgataaagaaagaaaag
ccagaagaagagaaacctgaggaagttaaattaaaaccagtcaaacgtcctgagaaacca
aaagaggagaaaccggaagaagtgaaattaaaacctgtgaaacatcttcctaaggaagaa
gaggaaaaagaagtggtaactctgaaaccaataaagaaagagaaaccagaggaagagaaa
cctgaagaagtgaaattgaaacctgtgaaacgtcttcctaaggaagaagaggaaaaagaa
gtggtaactctgaaaccaataaagaaagaaaaaccagaggaagagaaacccgaggaagtg
aaattaaaacctgtgaaacgtcttcctaaggaagaagaggaaaaagaagtgataacacta
aaaccagtaaagaaagaaaagccggaagaagagaaacccgaggaagtgaaattgaaacct
gtgaaacgtcttcctaaggaagaagaggaaaaagaagtggtaacactaaaaccagtaaag
aaagaaaaaccggaagaagagaaacccgaggaagtgaaattgaaacctgtgaaacgtctt
cctaaggaagaagaggaaaaagaagtgataacactaaaaccagtaaagaaagaaaagccg
gaagaagagaaacccgaggaagtgaaattgaaacctgtgaaacgtcttcctaaggaagaa
gaggaaaaaaaagtggtaactctgaaaccaataaagaaagaaaaaccagaggaagagaaa
cccgaggaagtgaaattaaaatctgtgaaacgtcttcctaaggaagaagaggaaaaagaa
gtggtaactctgaaaccgataaagaaagaaaaaccagaggaagagaaacccgaggaagtg
aaattaaaacctgtgaaacgtcttcctaaggaagaagaggaaaaagaagtgataacacta
aaaccagtaaagaaagaaaagccggaagaagagaaacccgaggaagtgaaattgaaacct
gtgaaacgtcttcctaaggaagaagaggaaaaagaagtggtaactctgaaaccaataaag
aaagaaaaaccagaggaagaaaaacctgaagaagtaaaattgaaacctgtgcaacgtttg
ccaaaagaagaagaagaaaaagaggaagtaattttgaaaccgataaagaaagaaaagcca
gaagaagagaaacctgaggaagttaaattaaaaccagtcaaacgtcctgagaaaccaaaa
gaggagaaaccggaagaagtgaaattaaaacctgtgaaacatcttcctaaggaagaagag
gaaaatgaagtggtaactctgaaaccaataaagaaagagaaaccagaggaagagaaacct
gaagaagtgaaattgaaacctgtgaaacgtcttcctaaagaagaagaggaaaaagaagtg
gtaacactaaaaccagtaaagaaagaaaagccgacagaagagaaacctgaagaagtaaaa
ctgaaaccaataaagaaagaaaaaccggaagaagagaaacccgaggaagtgaaattgaaa
cctgtgaaacgtcttcctaaggaagaagaggaaaaagaagtggtaacactaaaaccagta
aagaaagaaaagccagaagaagagaaacccgaggaagtgaaattaaaacctgtgaaacgt
cttcctaaggaagaagaggaaaaagaagtggtaactctgaaaccaataaagaaagaaaaa
ccagaggaagagaaacccgaggaagttaaattaaaaccagtcaaacgtcctgagaaacca
aaagaggagaaaccggaagaagtgaaattaaaaccaattccaaagtctgtttctgaaaaa
gttgaagagaaacctgaagatgaggcggaaaaaatattaccatggcgtcgtggcaagaag
acgaaaaagatcgttgatttccgagaagaagtcacagtggtaccaatcgatcaagagaaa
gtgattacagagatacacgacgaagagataaagattgtggaacaaaaagtggaggctaaa
aaaatagtccaagcggagataaaagaattcaaagaagagaaaccggaacttccgtggaga
acaacaaaagaagtaaaagagattattgaagagaaagttgtagttgaagaaattaagcct
gaaacggtactcaaagaagatgaagttattgaagatgtcactgaatcatcggaagtttct
tggagaaagaggcgaaaaccaaagaaaccggaaaaagagaaagaagtagttgaattgaaa
ccagtcgaaaaacacgaggaattcgtagaaagaatagaagaaattgttctcaaacctgtc
gaaaaagagaaattcgaggaaaaacctaaggaggaagaattgaaaccgcttaaattagaa
aaaccaaagaaacttgaagaagaagagatagaagaagagaaagtgaccgaaatgttatgg
aagaaaccagaagagatacctgtacctgtagaaaaagaagtttccacgcaagaagttcaa
gtaatcgaagcgactaaagtagaaaagattgttgaagatgtagtcgaagttgaaaagaaa
aaggtccaagtcgaggatcgtaggaggaaacacaagcaacgtacgcaagtcgagatatct
atcacggacaaagataagaaaattgcaccgagatttattcagaaacttcaacccgttatc
gcgcaacctgaaacaactgcgaaattcacgtgtacagtatttggcaatccattccctgaa
attacctggtacagaaacgagcaggaacttcacgcgagtgagaagtacataatgactatc
tacgaaacgaccgcatcgttggagataacgaaggtgaaggaagaggacgctggaatgtat
tcctgcagagcgtcaaatccggctggagtagctacgtccaccgtcaatctcgtgatattt
gaaaaagaagaagagggcatagcgccacatttcgcgacaccaataaagcctctcatggtg
gaggagcacaagccagctctgctcgaatgcatcgtcactggcacaccgatgccggaagtg
aagtggtaccgtggtgaagaagagctgaaaccagaaaagggcagagagatcacgttcaat
ccggaaactggggaggcgaagttgcacatattggaaccgaccgaggaggatgagacaata
tatcgcgtacgagccgtgaacaaattcggacgcgctgaatgcagagcgaatctggtcatt
agtaacgtggtgagggtgagcaaaccggaagttctgaggtcgccaaagatcactagacct
ctgccagctttggtcgccgagtttggaaagcctttgacgttgtccgctgatttcgagagc
aaacctacaccggaagtgaaatggtaccgtaacggagccgagatcgtaccgtctgacaag
cgtgtgattaagatttacgaaaatacgacggagttgtacattcctgaagtgacgaagaag
gatggagggaagtatgaggtccgagtggaaaatcctgtaggtgaggcgagaagttctggt
tctgtgacggtgaagaaacgagaggacaagacggatgaggtgaaagcaccgagatttatc
gagccgctgcaaccgcaaatcgtaaccgagggagaagtcgtgatcatggaaacacgtgtc
gattcctatccgacagcctctttccaatggttccacgatactcgtcctctggagtctacg
ccacaggtgaggatcgtaactcaagagaacaaatcgatcctaatgatcaaggagatcaag
cccgagtactcgggtacgtacacttgtcgtgccgagaacgttggcggatctgtcacttgc
acggcaaccataaatctactggatacgccttgggaggaaactgtggagctggtttcaccg
acgtttgtcaaacgattgtcgccggtcagggtcatggatggtgaaagcgctaacctgacg
tgcatcgttcagggaaaacccacacctagggtcgagtggtatcacgataacaaaccgatc
aaggagggcaaggagatcacgatcgtgcaagacacagaaggtgtttgcagtttggccata
actgaagtatttccagaggatgctggagaatacacttgtcgtgccgtgaatcctgttggg
gaagcggtttgcacatcgtcacttatcgtggaagcatacgagtacgtaccggattcagaa
atcgcttcttcgattgtcgcaacatctcttactacagggcaaagcggttcagaggaggat
cttttatctccaaaggaaacacctttgttcgatacggacgaggaatctgcgccagaaata
gtgaaaaaacttcctcaattaattcctaccaaagttggagaactaactaggttggaagtg
aaagtgaaaggaaaaccaaaaccagaaggaaaatggtacaagcagggcgtcgagatcgtg
tcgtcccaagaattcttgatcgaggaattcgaggatggcacttctgtgttaacgatagcc
gaaacttatccagacgacatgggtgagattgtgttcgaggtgcacaatccactcggcgta
tcgaccacgactacctatctatcggtagaaggaatcgtcggaacgaaggagtacagaaag
ccatcatgggtcacccagatggaggagatgcaagaagctctaagagccacgcaatctgta
ccacgattcattcaagagattaccgatgtttatgcgaaggaaggtgaaaccgcggtgttc
gaatgcatatactctggcaatcctgttccagacgttgtatggtataagaacgataagatg
atcaccaataccccgaacgtgaaaatacgtctcttggacgaggagaaaaagacaatattg
acaattaaacatgcgaccgaagaagacgatgccacttacgtgtgcaaagctacaagtgag
ataggtttaacaacgacgaaagctaaattacatgtaacagaaataactggcaagaaaatc
ttcatggacgaagaacaattcgaagagcaaatagtagaagagaaacctaaaaagaaaccg
gaagaagagaagcctcacaagaagaagaagccagaaatgaagaaggctaaagagacgaag
gaaaaagtgaaaggggaacgtgtaaagatagacaagaaggagttgcataaagagaaactg
attcccaaggaacagccagaagaaaagaaaattgtggatatcgaagaaactcaaacgctt
gaaacgacagaaattattgaagaacaaccgacagaggtaacacgagcaaagaaagtgatg
ccgatccaagagccactaataacagaggcgaccgcgtcattgaagaaaatcgacgatgaa
aaagcgcgggaaattatactaaagacggaagaacgcgcaaagagggtgttggaggagcga
gaaggagtggtggtttcagaaatggccatcgaagacacggcccgtgatttcacgatagaa
tcggtggtcgatcgtgcacagatcacgtcggagacattgcaaactgtctccgtgtcggaa
gtgcacacggaggccagcgttcaagagatcagacgagtggacacgaaaaggaaagcaaag
aaaaccgtggtgacagaggaggaggagcttccaagagaaatcgtagttgaggagaagccg
aaaaagaagaagaaggagaagctgaaagtgagggaagaagtgaccatcgaggaaatagtg
gagagacaaaaggagaatatcgcgagagaggtagaagaaattatggaaacacttcacgcg
aaagagttcgggccaggagaggctcctcttcgagaattggccaccatcggttttttggta
cgccagggtgtctctgtgaacgagatcaacgagagcttatacaaaacggacaatttccct
gcgttgaaaacccccgaggctcagaatgcgcttgtccaattggtcgagagggagggtcat
gggccattgattacccaagttctgacagaagaaacaactactgacgaaagtgtggtggct
gctaccgtcggcttccgcgccttcatgagaatgatcgagttgcaacacgtcaccgttgaa
gaagtcctcactcatttcgcaccggaggactttcgaccgcgagcttgggaggtcacagaa
gccacggaagttgaaacggaggaacggattacggaacgagtggatgtcatacacaaaacg
gaagtccatttcatggagaggagggacgaaagaaaagccatccgcacgcaggatattcga
gacattaaagaatacgaggacacacggcaggcacacacgacactgcgcgaacgaaaatta
acgaaaccgaaggaacaaatcgaggagaaaaaagaagataggggcgtgggggttcaggtt
gtagaaatcgaggaaattgaggaaaccgaaactgggaggaagaagacaaaggacgcggaa
gagattgaggaagaaatcgagacaattatcattgaaacagactcgaagcacaaactggct
caaaaagaaaagaaacgcgtggatgtagaagaagaggaaatcatagaaaaagagagaaag
gaattgatacctaaacggccacatattagacgaaatgaagttgaaatggaagaaatcgaa
gagttcgagataaaagaagacagatctatgccttccctcatattaaatgttcctagccaa
cgtcatcagataatacctttggatcgtaccatcgaacaagcacctggtaaaccagaattg
gaaaaagccaaactaacaatggacactattacgccgttaactgaacattttgtccctatt
caagagaaagaaatcgatgatattagccaaattaaacttatagaacgaaaagcatctttg
tctatttcgccaatagaaccttattccatcatggaaacaaccgtccaagcttctactggc
gaattcgcgggtatttttaaacctacattctacgaagcgacacgtggtatcgtgccatcc
gaaagtttggtaatcagcgaaactctggccaacgacgctggattatccagtttaatcatt
aataaacaggaaatcagtaaaactgcagatgttagtgtggctcttcaggaagccacgact
gtttatgaaaccatggtaagtcaaaaggaagctccaacagaagatttcgtgtcaccattg
actgttagagcagaagacattattcttcctcaaataggattgtctgtgtatgagattcag
gaaggattaacagaagataagttagaacccttgaagactttaccaactaaacctagagtg
aacatcgctgcggttgaaccattagttgtggaagaagttagagcagaggacaaaccagga
aagtattacccagaacttgtagttccgacagaggtcgccactgagaccgtaattcctcaa
cgacaacgagtgactgaggaaatgtacgcacctgaaaaggagggcatgtatgttccagga
agattaccacctagtcagaaagcacaagttggaatatcttatggaaacgaaactgctaca
gttcagcagaatatcgtacaggaaagtgaaggggtatttatttcagaaagaaaaactgac
acctttgaagctacgcccaatgtcactgtacttgaaggaatttccgtgtccacagttcaa
gctcaagatatagaaagcgacttaacgattgaagagatgaagaaagcagtagctgatttg
aacatcattgagatcacatcagcagtgacgagtgaaactgtgccatctgagaaagagaaa
gaatatcaactcgaagacaaacctgctatcaaaacggctgagacgtctatttccttattg
gaaatcggttccatcgcgagcactattattcaagagtctgaaggaatttatcatcctgat
cagaaaccaactaaagtattggcagaaacttctatcaaacctgaagaatatgtgcagata
tctgagattcaaacagcggattatccatctgattttaaggaagaattaaaatatgtgcaa
gaaagtggaacaattgctgtacaattaatagaggctaaaatgatccaggaaactatgacc
catgatcgtgaagcaaagatggaggaattaataaaaccagaagaacgtgttgtaaagaca
agttatgacgccattaaaagtgtcgaagtattccaaactacatccatagagaaggaagct
gatctaaaaatcttcgaaatgccagaatctcatcgtggaaagacagtaccaactcatcct
gttgtttcattggaaatcgaaatgactcaaccggaagataatttaggtatgataaaaaag
gaagttccatcatctagtatcgctaaaatagaacctattgctttgcaagaaaccataata
ggtgaaactgtgatcgctgaagatgtggcaccggttcaaaaagacaaagttcctgaattc
aagatagccgaagtgacgatgaacgagatcgagagtttacacaccacaatggtgatagct
agcgaaaaagaagctgaatatatagaaatttctgaaatgaaaggagcttatgctactaca
gaattcactacacaggtagcgccaattttcgaagagattagaactcactcacctacagaa
gaatatatctcggaaaagaaagcaatctccagcgtggctcaatcgtcgcacattccatta
gaaagtgtaacaattgctatgcaagaattggcagaaaaggaagacttgtacatgactgaa
atacaaccaaataagaagattgcgattgtcgaattgaccgaacctagacctggtccaatt
attcttgaagttatttctcatgatcgtgagaatgtgtacaatcctaatgtaaaaccacaa
gattacactgctgaaactttagtgtctggtcataaagttgcattaaaatctgagacttta
gtggaacaaagcactgctaacatgagcatcgataaacctcaatcaaaaaaggccatacca
caacgagatattttggaagaattgatcgtaacagagacaactattgctgagactgaaaag
attagagaagcggatattcttccaactatccaaagtgcagagattgaaattcaatcgaaa
actgaaaaattaaccgtgatcgaggtgacaagtatccaggaagaagaaaaattagaaata
gaaaagataccaaaggaaagaaaagttgttctgggtatcactggaggacatgaagtggct
gaaatgcaggaaactgttctagcaagtaatgttaacattttaaaagaagaaaaaatcaaa
gaagatcacgctaatcaacaacaaagtggattagaagttgtagagcagacggaaatatca
atctctgagaaagaatctcctcttcaaaaagacataagacctgatatcaaaatcgttgaa
gttacattccaagaaggggagagtattgtggtaggtataacgcatcctgaggataaagag
ggaatattcactccagaagaaaaaccaaaaaatgtagaagctacagtagatatcattacg
caaggagtagcatccaagtttgaaattttgagtgatacaggcttgagtgatttaccggat
gaaacggttcaaaagatgaaacctaaaactacgatattacctatcgaagctgcaattgct
caagaagtacacaccagagaaacagaggcaccattcagtgaaattaaacctaacgataag
aaagcgaatctcgagtttgtgacaggcgaaggtttgattatttcagcgattacaactgaa
gataaggagagtctacttccagaaactgaaaaaccaaaaaccaaatccgccagtttcgac
attccaacgcatttcgtagctcagaccatcgagactactactacagacaatgtaggcgaa
tttaaacgagaagaaatacatgtagctacagctataactgatcatatcacattccgcagt
gtgattacatctgaaacagctactggtgatcttgaaaaaccaatggaagacttcattcaa
ccggagaagaaaatgatcgatgtttctttccaggaggaagaaggcataacagtcattgaa
acaattgcatcagataaagagaaagagtacttcaagaagctagaaatgcaaggagaacag
gctactgcaagcttcgatgcacataaggttgcacaattaacagaaatcaatccagcttct
atttctggagatttaactatgcttgctccaattacagtagctgctaaggaagaacgatta
ccatttgaaagcattgttcaaacagaaaccattgtgtctgaaactgaaaaggaatttaag
gataaacctataattactaataaagcggaggtttctatcaatgaaatcattagtgcaacg
acaactactgagattccagctgataaagaagatattcttcagatatttgagaaaccatct
gagaaacaagctagtgtacaattcgctggacacatgattgcggaaaagattgaagtaact
gtcgattccagtgctggtaaattgaagaagataaaaccggtctccgcattagcagtgcca
tctagcatccccttagaagctgtaattagctcggaaattcaaccaactgaaattgaagga
ccatttatcaaagataaaagaccattgaaggctatagcagacttatctgtagtagaagag
caaagtgtacaagtatcagccgtgatcatggaagataaagaagaagaatacaagtctaaa
aatttaccagagataaagactgctggaaagagccttgtttctggtcatatagtagctgaa
acgactatgcagattgtagatttcagcactggagaattcattcaagaaaagccatcaggt
gctattgctatatcagaacatgttccgttcatttcattgatagaatctcaaccaattata
caggaaagcgaagacaaattcataccaggccaattaccagaaaacaagaccgccattgta
gatcttgaagagagtaaaaaaatcgtaattgtgtctcaagtaactccagcagacaaagaa
tctttatatatttctgaagaactgccatcaaagcatgcagcctcgtttggattagacacc
attcatggaattgctgaaacaaccactatctctgtagaggattcaataagtgaagtgaaa
ttaaagaaaccggacaccaagaaagcatcaactactcaagaattgtatcaaagcttgttg
gtcacgcaagacatcgttcaagatcaagaaaatacctttgaagagaagtttaagccaact
gttcaaaagatagaagtatctatcgaagaaggcaaacgtgtgactaatgttatcgaagtt
agcgcagccgataaagaagagatattaaagacagtccaagaagaaataagatcagtagtg
ccgattattgtctctggacacgaagtagcggaaagatctgaaattataccacatttgagt
actggagaaatggacatcattaagcctaccacagccactgcacaagtagggcaaaaacca
tttgaaacgatcgagatgatagaacaagttctagcagaaaaagaaatagacaaggtcgag
gaaatatcaccacagaagactaatgctcgaatcaccgtagacgaaaacagatttattgct
atcacagaagcgaccacagcacaagatgtcgaggctgaaatgtcgataattaagaaacct
cgcgaagaaatggcaaaatcatcgatggagggtaaagaagttgctgaacaaatggaagta
agtctcagagaagaattgggaaacttacctgtagcgcaacgaccaacaacatttgaagca
tatccgacgcaaatcacattagaatgcgttgatatcagtgagactattcctcaagaacat
agcacagtattcgaagaaaagatgaaggtagacgaacgaagtgcgaaagtgagctttgtt
gaaggaaagagcattaatatttctcatgttatttctcaagataaggaagatacaatgatt
atacaaaaacgtgaagagagcacagcggaaatgactctgacaaaggttggaatggatgta
gcacaaaaagctcaggtatttattgagcagagcactggattggttcagccatttgagaaa
cgcgaagtacaagctcatcataaacaggatgctctagaaccgattattgtggaagaaatt
ccaagtgcagaaagtgaaggagtttttgacaaatatccaaaaacagttttttctacagca
atacaaacgttcgagcaagatcatggaatatcgataacggaagtcacttcagcggaagta
gagtctgtgctgaaagaaaagaaaatggatatttcgcagacagctaatagtactcttatt
atggaacgtaatattgttgaaacatctatgatcgaatctcaaattagcataccggataaa
atagaacaaataagcatgaagcctcaagtagctgttcctgaacaagatactttcgagagc
atcatagtgaacgaaaatatagtggaagaaagcgagcgcacgttcgaagatgtgttccaa
cctcagactcaaaaagcagatatcgatatacaaaaagtgacatctcttcaggtatcagaa
acaatcacggaagataaggaaagtgttttcgatgtggtacctaaacgagaagaggtcaaa
gctacccaggacatcagtttgcacgaaaccgtgattggatctttagtagaaagtgttcag
agtattcaggaaattcacgaagagaaacgaatatcgtctcaagccacaatggctcaaact
gtgatagaaacagctgtaaaaatagagacaactgttggcgaaagagaagatacgttcgaa
ggaaaaaactttaaacttgaacagcaaaaaggcaaacctcagatggaaggactcagcact
gtcattgtcacggaaattgtttctaatgagattgaagatgttttaccagcaacagttaca
cccaaagaacaacaggctcagcctattcttacaggcagagaagttccagaagtaacacaa
gtaattgctgcgtcgactactgaagaattcgaaaaagtaactcaattgaaaaaacagcaa
ggcaaaatagaaatggaagagatgtcttccgtcacaatttctgaagtaatctctaatgaa
accgaagatatatttgttttgaaaaccatacctaaagatcagaaagcaaactttaatatt
ttaggcaatgaaatcgcagaaacgtctcaagtaaccactataatagaaacagaagatctt
gcattgaaaagacccgaagaacaaaagggaaaacctacattagatgaattgacatctctc
acagtttcacatgtggtatccgaagaagcagaggaaacattatcattggctaaagttcca
aaagaaaagacagctcacccaagtttgaccggaagagatgttgcggagatcatacaaata
ttggctattgctagtgtcgagaaattcgtagcatctaaggctccggaagaacagaaaggt
aagatacaagtggaggaattggcacctttaactgtctcacaagtaatttctcaagaagcg
gaggaaacattacctacaccggaaataccggtcgaaagagaggcccaacccagccttata
agcagagatgtggcacaaacaatggaaatattgactatggcaaatattgatactttagct
gaagataaaaagcctggagaacaaaaaagtgttcctggtttggaggaatttgttccttta
tccgtattacagacgatttctacggaaacggaggacgtgttagtcagtcctaaagtaccg
acaaagaaaattgctcaatcgagtttgaccggtcacgatgtggcagagacaatgcagata
ttaactatgatggctactaaggaattaatagctgatcgtgcaccagaaaaacaaaaagga
aaaccaaatatagaagaattgacatccgttatggtttctcaaacagtatttcatgagact
gaagagacattggaggaacaggtagctccaagtacagtgattgctaaacctgcactgaca
ggtagagaagtcgctgaaattagtcaggttcttactgtggctaatgtagaggaattagaa
aaaggtaaactaccagaacaacagaaaggaaaaccaaacgtggaggaactgacttctatt
acagtttctcaagcagtgtttcatgagactgaagaaacattggaaaaacaggcagctcca
agtacagtgattgctaaacctgcactgacgggcagagaagtcgctgaagtcagtcaaatt
cttactgtggctaatgtagaggaattagaaaaagataaactaccagaacaacaaaaagga
aaaccaaatgtagaggaattgacttctatcacggtttctcaaacggtatctcacgaaact
gaagagatattgaaacagataactccaagtacaatgattgctaaacctgcattaacaggt
agagaagttgctgaagtcagtcaagttcttactgaagttagtataaaggaactagaaaaa
gataaaccacctgaacaacataaaggaaaactaaatgtggaggaattgacttctatcacg
gtttctcaaacaatgtttcatgaaattgaagagacgttggagaaacaggtagctccaagt
acagtgattgctaaacctgcactaacgggcagagaagtcgctgaagtcagtcaaattctt
actgtggctaatgtagaggaattagaaaaagataaactaccggaacaacagaaaggaaaa
ccaaatgtggaggaactgacttctatcacagtttctcaaacagtgtttcatgagactgaa
gagacattggagaaacaggtagctccaagtacagtgattgctaaacctgcactgacgggc
agagaaatcgctgaagtcagtcaaattcttactgtggctaatgtagaggaattagaaaaa
gataaactaccggaacaacagaaaggaaaaccaaatgtggaggaactgacttctatcaca
gtttctcaaacagtgtttcatgagactgaagaaacattggaaaaacaggcagctccaagt
acagtgattgctaaacctgcactgacaggtagagaagtcgctgaagtcagtcaaattctt
actgtcactagtgcagaggaattagaaaaagataaattaccggaacaacagaaaggaaaa
ccaaatgtggaggaattgacttctatcacggtttctcaaacagtgtttcatgagactgaa
gaaacattggaaaaacagatagttccaagtacagtgattgctaaacctgcactgacaggt
agagaagttgctgaagtcagtcaaattcttactgtgactagtgcagaggaattagaaaaa
gataaactaccggaacaacagaaaggaaaaccaaatgtggaggaactgacttctattaca
gtttctcaaacagtatctcatgagactgaagaaacattggaaaaacagatagttccaagt
acagtgattgctaaacctgcactgacaggtagagaagttgctgaagtcagtcaaattctt
actgtgactagtgcagaggaattagaaaaagataaactaccggaacaacagaaaggaaaa
ccaaatgtggaggaactgacttctattacagtttctcaaacagtatctcatgagacagaa
gagacattggagaaacaaatagttccaagtgcagcgacagctacgcctgcattattagga
agagaggttgctgagattagtcaagttcttacggtgactagcatagaagaattagaaaaa
cgtacattgcccgaagagcaaaagggaaaaccaagattggatgaacttacatccataact
atttctcaaatagtatcaattgagttagaagacaaattaccatctcctgagaagccaagc
gagaagatcgcacaaccgcagatagctggcagagaagtagctcagaaaacagagatttta
acagtgactaatgtcgaagaattggaaaaatcggagaaaccagaaagtcaaaaaggaaga
ccggatgtggaggaactaagctttctcaccgtttccgaagtggtgtccacagaagcagaa
aaagaattacctactccaaaagctcccaaagaacataaagcgcttccacaattggatagt
atcgaagtagcagaaacatctgaaatattaacaataacaaatacagaagaacttccaaaa
tctaaaattcctgaagaacaaaaaggaaaacctcaattagaggaattgctttctttatct
gtctcagaaattgcatttggtgaaatggaaaagaatctcgctactccagatgaacccact
attcaaacagctaagcctagtttaataggcatccaagttgctcagaaatctcaagtaatt
ccatcagtcacggctggagaattgcaaaaagagatgaaaccagctgccaaacaaataatt
cctgaacaaataccattcgaaagtattgagcaattgcaagcagtggcccaggaaagcgaa
gatatctttgttgtggaaaaaataggcaaatcagttaaagctgagatgtcgttccgcgtg
tctgaaagcgtggaagtgacgcaggtaatggctacggaacaagaatcaaaagaggtgatt
aaaggcgttgccaaagaagtttctgctcaacctgatgtaatcaaacacgaggttgctttg
aaaacagaagtccagttagcagacgtagctgatgaattcaaagtgataaaaccggaaggc
aaaatggccaaaggtgtagatgagattcaacagagtgtaatcgttacagaaccactgaat
gccggtgagattgagtcagaaatgtccgagtctgtattaccttccgcaaagttagcgaac
attattgtcgaagcagaacacctggaacacgttatggatatcacggaggaaattgtagaa
cagaaagctgtcgaggaaatcaagaaaccaaagattattaagaaaaaacctcttaaagct
aaaaatgaagtaacagaggaagtcgtagaaggaataataatagagcaacctgatgaacaa
gaggcacaaccaattatggaagaattagaaacagtaacaatcactgaacacgatgtacga
aatataccgaagaaaaagaaagaggtcgtcattaaagaggaagaagaaatcttcgagacg
atcgagacacctactcaaaaaattattagaaaaaagattcgtcctatgaaaaaaggagga
gaagaaatcgtggtggaagaaataattcagaaaccacgcgaggaaacaatagaaatggag
aaacaaagaataatagaagtgatcgagacacctataaagaaagtagtgaagaaaataaaa
gcggtagtaaaagatgacggtgttcccgaagagattgttgaagagatcgtaattgagaaa
ccacagaaagaaaaagcgaaatctattattgaagaagaaaaggaaaaggtcaaagtaatg
aagattgatctgaaacaagcacccaaaaaaccggaagaaatagttgaagaagaagaagaa
ataattgaaattattgaaactccaatgcaaaaaatcattaaaaagaaatcaaaagataaa
aagaagaagatagtggaagaagttatacagaaaacaatagaagatgcaaaggcaatggag
gaacgtaaaattgtggaaatcattgaaacaccgacaaagaaaataatcaagaagaagaaa
gcgattttcacagaaggaaaaacccctgaagaggaagttgaagaaatcgtgattgaaaaa
cctgttaacgaaaaagtccaaaaagatgtcgtacctcaagaaggcatagaaatcactgaa
attattgctgaaacttctatcgaacagttacctgaaaagaaacttaaaccagaagagagc
aaagtctcagaagtggaagaagaaaaaacagagatcacgcagatagaaatggaaaaaata
ccaaagaagaaaaaaccaattgcaacaattgagccagaagacaaagaagagatcatagaa
gaaataaagcctgaaatgaaaaaagaaaaagctaaaccaactgagaaagaaagcgttgag
ataactgaagtgatttctgaagtaataacagaaaaacttcctgaagaaattatgaaaaag
aaagctactaaaattaaggaaacggaagaaaagataataaagaaggaaataaaaataaag
gaagcaccgaaggaagctgtacctcaaacagaagaacagctagaagaagaagtacaagaa
ttaattacagagaaactaaagaaaactaaagcaaagaaagaagtcatgtctcaagatagt
atcataattaccgaagtcatttctacaactgcagaagaagcgttagaagtaaaaaaaccg
gaagaagataaagctgtaataatcaaagaaaaggaagagaaaggtaaagtagaagagaag
aaagtaattgtgaaaaaggctaaaaagaaacttataccaacggaagctgaagaggaacaa
atagaagaaataatagaagaaataacaccagaagaactaaaaatgaaaaaagctaaaaag
actattcttcctaaggaagagatacagataaccgaaatgattcctgaaattaaaacagaa
gagataaaagagaaacaaccaaaagaagaaaaagctgttcctaaagaggaagagaaagtg
gaagaagaggcaaaaattactgaagtttccgtaaagaaagtacccaaagaagaggaaaag
aaagaaattataacgaacggtgagattggagaaaagccaaaagtaaaagaaattcctgaa
gaaagacctgaattaaaagaagctccaaagacagaaaaattcaaaaaagagaaaccaaaa
gaaataaaaccagaagaaaaggaagagaaattaaaaaagaaaaaaataccagaaaagaaa
cctattattacggaagaggaacagttcgacgaaaaaatagaagaaatagtagaagaaaaa
ccaaggaaagtcgagcccaagaaagaaattatatcaaaagaaactatttcagaaattgtt
gccgaagaattatcaacgagaaaacctgaggaacataaagtaatatctgtcgaagaaaaa
tcagatgaaaaatttacggttgaagaagtcttagtagaaaaagatctagaaaagaaagag
aaagaaatattagaagaaaaatcgatcgaggaaattcatgagaaaccaaaggaaataaag
aagaagaagaaaaagaagatagttaagaaagaaaatattgaagaatgggtagaaccagaa
tatgaacgacctgtactggaacctatgcctgaaaagatacaatgggaaccaaaaaagaag
aaagtaaagaaacctttaccagaatccttgcagaaactggtacctcagaaaatcgaaaga
aaagagatcaaacccatgaagttaaaatattcagaacctacagaaactgttcagtttgct
gcaattaaattaaagaaagtagtgattccgaaaaagaaggaaattgaagaatccaagttc
ccgaaaattatgttacgaagtagaattacatttgtcggagattatccacctgaaatacaa
tatccaaagataagcgaactggaagtaaatccagttcaaacgggtattctgtctagaaat
acggaagaagctcttgaaattctaaaaaggaaagtgaagaagattaaacttcccaagaaa
gaagtcacagaattagaaaaattggatcaagaattcgaagaattgaaaaaggttcctttg
gaaaaaatagaggacaaattgatatatgaacgtccgccaaagaaacctgcagaaaaacca
gaagaaccacaaaagttagttgttggaaaaggcaaggtgccagaagaaaagaaagcagaa
cctgaaatgatgaaattaaaaaagattcctgaaaagaaaccggaaaaaattgaagaaccg
ttgaagaaaccagtcaaaccagagtctgaagagaaaattaaggcagaaaagaaggagaaa
ccaaagatgaaattagaacatgaagaactgagaccattggaatttgacaaatcagagctc
gaaaaatatgtgcctgaagagcatgaggaatcagaaaaaccaccaccagaaccaatgcca
aaaccatatgaaagagaaaaaaagaaaaaaccagatcaagaaatagaacaaattccatta
ataaaaggagaacctaaactaccagaaccagataaagaaccggaagttaagtttagaata
cctcagaaagaaaaaccagaggaagaaccggaaaaaataacgttgaaaggctggaagaaa
gataaacctgaggatgaagatatcaaagagtttcctgcaaaggaagaagaagaagaagct
cctacagcgcctaaaaaagaagcagaagagattattctgaagcgcaaagtaaaactaaag
aaacctaaagaaaaagctactaaagaggaagaggttacattcaaaaaaccagaagaaaag
aaaccgaaagaagttattgaagaaatcacgctgaagaaagaacctgagaaatcaatggaa
caagttccagaaatatttattaaaaaaccagttgtagaggaaaaagaaatagaagaaaag
gaaacaattactgaagtaacattgaaaaaaccagaagaaaagatatctgaggaaataatt
gaagaaataaagaaacctgaggcaaagaaacctgtgaagaaagaaactagtgatgaaatc
actgtaaaaaaatctattgtggaagaaaagaaagaagaggaaattcctgaacaaataata
cttaagaaaaagaaaccaaaagaaaaaccaattccagaggaaataaaagaagagattaca
ttaaagaaactaaaggaaaaagtgtctgaagaagaacagatagaaatcaagaaacctaaa
gaaaagaaatcagttgagaaagaagcaactagtgagatcaccattaaaaagcctgtagaa
aacgaagaagaagaaatcctagaagaagtgactttaaagaaaaagaaaccagttctagaa
gaagtaaaggaagagattacattgaaaaaaccaataccaaaagaaaaagtgccggaagaa
ataagcgaacaaatagagataaagaaaccgaaaaagaaaaaacctgtagaagaagaggca
gctgatgaaattactatcaagaaacctgagactgtagaaaaagaagaagaagagattaca
gaggaagttacattgaaaaagaaaaaacctaaagagaaaccagttttagaagaagtgaag
gaagaggttacattgaaaaaaccaattccaaaagaaaaagtgccggaagaagtaaccgaa
caagtagagataaagaaaccgaaaaagaaaaaacctgtagaagaagaggcagctgatgaa
atcactatcaagaaacctgtgtctatagaaaaagaagaagaagagattacagaggaggtt
acattgaaaaagaaaaaacctaaagagaaaccagttttagaagaagtgaaggaagaagtt
acattgaagaaaccaattccaaaagaaaaagtgccagaagaaataaccgaacaagtagag
ataaagaaaccgaaaaagaaaaaacctgtagaagaagaggcagctgatgaaattactatc
aagaaacctgagcctatagaaaaagaagaagaagagattatagaggaggttacattgaaa
aagaaaaaacctaaagagaaatcagttttagaagaagtgaaggaagaggttacattgaaa
aaaccagttccaaaagaaaaagtgccagaagaaataaccgaacaagtagaaataaagaaa
ccgaaaaagaaaaaacctgtagaagaagaggcagctgatgaaattactatcaagaaacct
gagcctatagaaaaagaagaagaagagattatagaggaggttacattgaaaaagaaaaaa
cctaaagagaaatcagttttagaagaagtgaaggaagaggttacattgaaaaaaccagtt
ccaaaagaaaaagtgccagaagaaataaccgaacaagtagaaataaagaaaccgaaaaag
aaaaaacctgtagaagaagaggcagctgatgaaattactatcaagaaacctgagcctata
gaaaaagaagaagaagagattatagaggaggttacattgaaaaagaaaaaacctaaagag
aaatcagttttagaagaagtgaaggaagaggttacattgaaaaaaccaattccaaaagaa
aaagtgccggaagaagtaaccgaacaagtagagataaagaaaccgaaaaagaaaaaacct
gtagaagaagaagcagctgatgaaattactatcaagaaacctgagcctgtagaaaaagaa
gaagaagagattacagaggaggttacattgaaaaagaaaaaacctaaagagaaaccagtt
ttagaagaagtgaaggaagaggttacattgaaaaaaccaattccaaaagaaaaagtgccg
gaagaagtaaccgaacaagtagagataaagaaaccgaaaaagaaaaaacctgtagaagaa
gaggcagctgatgaaattactatcaagaaacctgagcttgtagaaaaagaagaagaagag
attacagaggatattacattgaaaaagaaaaaacctaaagagaaaccagttttagaagaa
gtaacggaagaaattacactcaaaaaaccaaaagaaaaagaaaaagtacttgaagaagta
actgaaaaaatagaagtgaaaaaatctaagaagaaaaaaccgatagtagaagaagctgcc
gatgaagtaacgatcaaaaaaatcgttgaagaagaaacgaaagaagaggaggctcctgag
gaggttgtactaagaccaaaatcgaagaggaaatcaatcgtagaagaagaagaagaagtc
actgaagtaaccatcacaaaaccaaaaccggtcgaagaagaaaagaaatcgaaagaagtt
gaagtatttctgaaaaagaagaagccggttgttgaggaagaagttgccgatgtaaccgtc
aaaaagttgatttcaacagaagctgaggaagtgcccgaagaatttactatcaagaaaaag
aaaaaaccagaaaagaaaccgacggtcccggaggaagtcgaagaaactgccataaccata
aagaaagttcgtggtcccgaggaaagaaaagaagaaggggaagtatcaactgaaatacaa
ataaagaagaagaaacctgaacgcaaagtcaaagaagaagcgactgaagagttaactatt
aaaaaattcgaagaattgaaagaacctgaagaaaaggaagaggtgcaagaattcaccgtg
aaacgaaaacctccgaagcagccccctaaaccgatcgaagagatctacgaagatgttact
cttcgaaaattacgtccaaagaggaaaccaaggccagatatcaatgaagtaaccgaggtg
gaaaacgtaacgttccgaccacggtccacaaagaccaaagaagacgtagaacaagaattc
aagatctcattgaacacctacgaagaagaagatatttcgatgtccggtaaagttcgacta
aagcccaagaaacggccaatgacatattctgaagaggctggagaagaaacgatcaaaata
atacaggaaatcgaggatgattcgggacctatcatagaagagatcatagaatcggatgaa
gaggccaaggatcaatatagtattgaggaattggaaactgatgaaatgaggcttccattc
agaaagaggaagaagaaggaacctaaaccatataaagtggaagatgtcgaggagggtgat
gtgaaactgaaattgaaacatgaaagaaaatattccatagaggaaattgacgaaacattg
gcattgaaattgaaggccaaaagacgcgtgtccacttatgaagaagaagaggcgtcactt
agtatcaccagagaagaagatatttcagagggagaagaaatcgaatatgttgtccgcgat
ggcgacacaatgttctcgatttgctcgtatgtggcagaaaccgacgaagctattaacctc
gttgaaggagaaagagtttacattatcgatcacacgaatcaggattggtggttcgtgaaa
aaacatttgacagaagaaaaaggttgggttccagcgcaatatcttctcaacgaagtccat
tatactcattatctgcaacgcaaattacatgaaaaaattgacaaattacctgtatttgaa
aaacctggtcctggagagaaaacatcagcaccgagatttatcgaaaaattgcagccaatt
catacaccagatggttacacggttcaatttgaatgtcaagtggaaggtttaccaaggcct
caaatcacatggttccgacaaactgccatcattaaaccgtcccctgacttccaaatgtac
tacgatgatgataatgtagcaactctgataatcagggaagtattccctgaagatgctggc
actttcacctgtgtcgccaaaaacgctgctggttttgcttccagtactacggaattgatc
gtggaagcgcctctttctgatcatggatcagatctgactggtccatccagaaaaagtctg
tcaagagaatcatcgcttgccgatatcttggaaggaataccaccgacattctctcgaaaa
ccaaaagcgaaatatgtcaacgaaggtgaagatgtgattctggaatgtcgattggtagca
gtaccggaacctgaaataacgtggtactacaaggatatgcagatcacaaccaaagagaac
atcgtagttgctactgaaagtgatatgcatatgtactgcagcgtgattaaaattaccaaa
gtacaaaagaaacaggaaggaaagtacaccatcatcgctaagaacagagaaggtgaagct
accattgagattcctatgaaggtgaagactggtaaacacgaaccaccagagattttagag
ccattgcaatcatatgtgatacgagagggtgaaaccgtggtgttatcgacacaaatcgta
ggaaatccagctcctaaagtgacttggtacaagaatggtaaaccattgaaggatctgatc
ccgaaacaagatggccacgtgaacacattaacattgattcaacctcaagtatctgacagt
ggagattattctgtcacagctattaacgatctcggcaaggttgaaacgaaagctacattg
acagttgaaataaacttgaatccttcgctgaccattagcttccaacaacatgcgtacgaa
cactacactttaaccaaggagataccaagcggagcaccagaaccgccacttttcacggaa
cgattccaagaacttactgttccgcaaaaaggtaccttcaaattggtcgcgaaagttact
ggaaatcctgtaccggaagtcacgtggttaagaaataataaacccttagaaaaatcgccg
aatatcattgaaacttatgatggtgagaacatcgtgttggagatcaggaacgcggattca
gaggtggatgcaggagattataaatgcattgctagtaatccagttggaaaagcctctcat
ggtgccaaagttacggtggatgtagaaaaggtaacgttcacgaaaactctggagaaggaa
atgattgtcgacgagtacaagactttggaattaatttgcgaaacatcgcacacggtatcg
acgaaatggtggcacaacgataaggagatcagtggaatggatcatcgtgaaattgttcaa
gaaggacgagtgcacaaattggtgatcaaaagaactagtcctactgatgaaggaacttac
aagtgcactgtaaagaatcaatcaacatctagcaaagttactgtaaaagctaccaaacca
gaattcgtgaagaagttacaagactgcgaagtaaaggagcgtgacgtcaccattttggaa
gttgagatcacgtcacagacagcagatgtgaaatggttcaaagatggcgagtccttggga
ccaagtaaagaaaaattagaattcgtgaaagatggcactattagaaaattactaattaga
aacacgtccgtccatgatgaaggagaatacacgtgcacccttatggatgagaaatgtaca
gcggaagtcactgttattgaattaccaccagaaatcatcacaaagatgcaagacgtgacg
atagcaagaggcgagagagcgactttcgaaatagaattgacgaaaggagatgctttggtt
cgatggttcaaagatggccaagaattacaattttccgaacacgtacaactgtcgatagat
ggcaagaggcagagattgaaaatatatgatacagaaccagaagacgcaggtgtttattcc
tgcgaagtcggtcaacaaaaatcatctgccaaattgatcgtggaagaaccaggcgtggac
ttcatcactagattaccagatgtcacacttgtaccgttgaatgcagatgccgttttcctc
attgaaatatcgcgggacgttccagttacatggatgagaaaatcagaagtaattaaggaa
tcatcgaaatatagcatcgtcgatgaaggcacaataaagaaactgatagtgaagaaatgt
accactaaagatatttcagaatacacagctgctgtaacaaatgtgaaaacatcatcgaaa
ttaagagtcgaagtcattgaagtggcaccaaagattaatccagacacacccaagaaatac
aaggtaagaaaaggtgaagacgtcgaaatagtggtgaaattcagctcaacaccgaaacca
aatgacgaatggacagtaaatggccatgtggttacgaaatcgaaacgtgttgtgccttcg
atcgatgaagaatccgcgatcttaactatcagaaagatccaagaagaagatgttggtgat
tatactctgaaactggtgaacaatgttggagaggctagcatagaaatcaacgtcgtcatc
gttcaggtaccaagtgcaccaggtgcaccagaaccattggaaataactgagaacagtgtc
acgcttcactggaagaaaccagactcaaatggaaactcacctattgtcgagtacattctg
gagcaccaagaaaagactgaaactacgtggaccaaaattgcagaaacgataaaagaaaca
actcacaaagtaacaaaattaactacgaacaaagaatataccttccgtgtaacagctgca
aacgaagctggaccaggcgaaacatcaccaacttctccatacataaaaataacaaaacca
tcggctgcagaaccaccaattatcttagaacctctgaagagtgttgtcgttggccttggg
gaaaccgtcagtttaacttgcgtcattggtggaacaccggctcctgagattacttggtta
agaaatggagaaattttcgaagatatcaatatcacatacgaaaaccgtgtgtccaagtac
accatcacgaggacaacggaaacttcatcggcaagcttcactgtgaaagcgaagaacgac
ataggaacagcggagacaacgtgtgaattgaaggtgcaagagccgcctaagatcatttac
gacgaaacattggcaagccaaaatcttcccgtgaacggtcaatggaagatcgagattcag
atgagcggatttccaaaaccagaaataacgtggttgaagaacaacaagaagatagtcgac
aaacgtgtgtctattgaaacagtagaaaatacatctaccatctttatttcttcgcttagc
agggaagatagcgccacttacacggtgaaggctgtgaatgaagctggcagctcttcagtt
gaattacatcttagagtaatagataagcctagcaagcctcaaggaccagtggtcttcaaa
aaaatcaggcaagatcgtgtcactattgaatggcggccaccggaagacgatggtggaatc
gaactcgagaagtacacgatcgaaaagtacgaacctggcaagacttggacgaaagtggtc
gatatcgataaagaagtagaaagtttctgcgtgcataaattgcaacagaatgccgagtat
aagttcagaatcatcgccaggaacgctgttggagcctctgaaccactggaatcggaaacg
gtcaagatgaggacttccttcgaaccacctggaccaccaagaggacctctggaagtatca
ggaatgacgaaaacatcgttcacgataaaatggcaggctccagaaaacgatggtggaaca
ccaataacagaatacatcatcgagattaaagaagaatcgaagaaagcttggcaaaaaatt
ggcagcacaaagcacgaaacgacacaattcggcgtatcgaatctaaagacagatgtgcca
tacaactttaggataacagctaaaaacagcgttggcactggacctccttatgtagctgaa
gaaccaattgcaccaggcagacgaatcaaaataacaaaaatgaccgaaagcactatgtac
gctctgcttggtatatttccgccgacgaaaataattatcagcaaaacaccaccatcgagt
ccgcaacatgtgcaagtaataaatgttaccagcaagagcgtgacactcagttggtctcca
ccagccagcaatggaggaacagaactcacaggatacataatcgaaaagaggccattgatt
ggaaaaggagcaagatggacgaaagttgtcaccttggacgctaccacacttcaatattgt
atagagaatttgaaagagagcgaatttatcttcagaatcttcgctgagaacaacatggga
ctcagtttacctacaaactcagaaccagttaccttgatgacacatgccaatgttccatca
ccaccaactgcaccattagaaatcaggcagattgcagcaaacacggtcgttatttcgtgg
ggcaggccggaatcagatggcggtgcgccattggaaagttacaaaattgctattagagat
gcaaagaagaccatgtggatggaagtaggcagagtgaatgcagatacacagaaattgaat
atcagggatcttcaggagaatcacatgtatctaatcaggatttttgccaaaaacgaagtc
ggtctcagtgatcctctagagtctgatgaacctgtcaaaatcataccagcttccgaatta
gccgtagtggagccaatcgcagaaatgacagaaaagggtgaaaccgcatcagtcagtttc
agcacagagaacacgagttcttggctacgcgaacacaacatggatgccgacatccattcg
tacgcgagagcaagacttcttagacaagacgagtacttcttccgcatttggcattatgct
aagaaacttttcgaataa

DBGET integrated database retrieval system