KEGG   Apis mellifera (honey bee): 551313Help
Entry
551313            CDS       T01057                                 

Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:ame00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    551313
Protein phosphatases and associated proteins [BR:ame01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     551313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 551313
NCBI-ProteinID: XP_623751
BEEBASE: GB44903
UniProt: A0A088A117
Position
LG11
AA seq 162 aa AA seqDB search
MELCSNFDVDEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDADGNG
EVDFKEFIHGVSQFSVKGDKESKLRFAFRIYDMDNDGFISNGELFQVLKMMVGNNLKDTQ
LQQIVDKTILFADKDEDGKISFEEFCSVVGNTDIHKKMVVDV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggaactatgttccaattttgatgttgatgaaattagaagattaggaaaacgatttcgg
aagttagatttagataatagtggtgctttaagcattgatgagtttatgtcattgccagaa
ttacaacaaaatcctttagtacaacgtgttatagatatattcgatgctgatggtaatgga
gaagtagattttaaagaatttattcatggtgtttctcaattcagtgttaagggagataaa
gaaagtaaattaagatttgcatttagaatttatgatatggataatgatggttttataagc
aatggagaattatttcaagtattaaaaatgatggttggtaataacttgaaagatacacag
ttacaacaaattgttgataaaacaatattatttgctgataaggatgaagatggcaaaatt
agtttcgaagaattttgttctgttgttggtaatacagatattcataagaaaatggtggtt
gatgtttaa

DBGET integrated database retrieval system