KEGG   Apis mellifera (honey bee): 551331
Entry
551331            CDS       T01057                                 
Name
(RefSeq) splicing factor 3B subunit 1 isoform X2
  KO
K12828  splicing factor 3B subunit 1
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    551331
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ame03041]
    551331
   03036 Chromosome and associated proteins [BR:ame03036]
    551331
Spliceosome [BR:ame03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    551331
 Complex B
    551331
 Complex C
   U2 SnRNP specific factors
    551331
Chromosome and associated proteins [BR:ame03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    551331
SSDB
Motif
Pfam: SF3b1 HEAT_2 DUF6700 IFRD UNC45-central DUF1428
Other DBs
NCBI-GeneID: 551331
NCBI-ProteinID: XP_016766955
BEEBASE: GB53725
UniProt: A0A7M7IF84
Position
LG3:8323336..8331463
AA seq 1160 aa
MREQLLKGEETELRKKLAEKAKEGTLKANGEPKPAPKKRGRWDQTDDAPTPKKPTGTTAT
PTSWDNADVTPAAIRWDETPGHGKGGETPGATPGLSTRMWDATPGHATPGAATPGRETPS
HEKAVSSRRNRWDETPKTERETPGHSGWAETPRTDRVAGDLIQETPTPSASKRRSRWDET
PSNQTPGSMTPQTPATPLTTPHQTSILTPSGVTPTGPKAMGLATPTPGHLMSMTPEQLQA
YRWEREIDERNRPLSDDELDALFPPGYKVLQPPAGYIPIRTPARKLTATPTPIAGTPQGF
FIQTEDKTAKFVDNQPKGNLPFMKPEDAQYFDKLLVDVDEETLSPEEQKERKIMKLLLKI
KNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLD
DLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNIDEYV
RNTTARAFAVVASALGIPSLLPFLKAVCRSKKSWQARHTGIKIVQQIAILMGCAILPHLK
SLVEIIEHGLVDEQQKVRTITALAIAALAEAATPYGIESFDSVLKPLWKGIRTHRGKGLA
AFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEAQ
YIKDEILPHFFKHFWNHRMALDRRNYRQLVDTTVEIANKVGASEIINRVVDDLKDENEQY
RKMVMETIEKIMGNLGAADVDSRLEEQLIDGILYAFQEQTTEDVVMLNGFGTIVNTLGKR
VKAYLPQICGTILWRLNNKSAKVRQQAADLISRIAVVMKTCQEEKLMGHLGVVLYEYLGE
EYPEVLGSILGALKAIVNVIGMTKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIAD
RGPEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQ
ERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKD
YIYAVSPLLEDALMDRDLVHRQTACAAIKHMALGVYGFGCEDALIHLLNHVWPNVFETSP
HLVQAFMDAVDGLRVALGPIKILQYTLQGLFHPARKVRDVYWKIYNSLYIGGQDALVAGY
PRIMNDPKNQYIRYELDYVL
NT seq 3483 nt   +upstreamnt  +downstreamnt
atgcgggaacaattactgaaaggagaagaaactgaattaagaaaaaaactagcagagaaa
gctaaagaaggaacattaaaagcaaatggtgaacctaaacctgcacctaaaaaaagaggt
cgttgggatcaaacagatgatgctccaacaccaaaaaaacctactggtacaactgcaaca
ccaacatcctgggataatgcagatgtgacaccagctgcaattagatgggatgaaacacct
ggacatggtaaaggtggagaaactcctggtgcaacaccagggctaagtacaagaatgtgg
gatgctactccaggacatgcaacacctggtgcagctactcctggtagagaaactccatct
catgaaaaagctgtttcaagtcgtagaaatcgttgggatgaaacaccaaaaactgaacgt
gaaacacctggtcatagtggttgggcagagactccaagaacagatcgagttgcgggagat
ttaattcaggaaacacctactccttcggctagcaaacgtcgaagtcgatgggatgaaaca
ccttcgaatcaaacccctggatctatgacgccacaaactccggcaactcctcttacaaca
ccacatcaaacttcaattttaacacctagtggtgtaacaccaacaggacccaaagctatg
ggattggcaactccaacaccaggacatttaatgtcaatgacgccagaacaacttcaagca
tatcgctgggaacgagaaattgatgagaggaataggccactttcagatgatgaattagat
gctttattcccacctggatacaaagttttgcaaccacctgcaggatatattccaattcgt
acacctgcaaggaaacttactgctaccccaacacctatcgcgggtacaccacaaggattt
ttcattcaaacggaagataaaacagcaaaatttgtagacaatcaaccaaaaggaaatttg
ccttttatgaaacctgaagacgcacaatattttgataaattattagttgatgttgatgaa
gaaacacttagtcctgaagaacagaaagaaagaaaaatcatgaaattattattaaaaatt
aaaaatggtacaccaccaatgaggaaagctgcactgagacaaattacagataaagcaaga
gaatttggtgcaggtcctttatttaatcagatacttccactccttatgtctcctacactg
gaagatcaagaacgtcatcttcttgtaaaagttattgatcgtattctttataaactcgat
gatttggttagaccttatgtacataagattttagtcgttattgaacctttgcttattgat
gaagactattatgctcgtgtcgaaggtagagaaattatctctaatttggcaaaagctgct
ggtttggcaacaatgatttccacaatgagaccagatattgacaatattgatgaatacgtc
cgtaatacaacagccagagcatttgctgtggtagcatcagccttaggaattccttcttta
cttccattccttaaagctgtatgtcgcagtaaaaaatcatggcaagctcgtcatactggt
ataaaaattgtacaacaaattgctattcttatgggatgtgctatattaccacatttaaag
agtttggttgaaattatagaacatggtctcgttgacgaacaacaaaaagttcgaactatc
actgctttagcaattgctgctttagctgaagcagctacaccttatggtatcgaaagtttc
gattctgttttaaaaccactttggaaaggtattcgtactcatagaggaaaaggtctcgct
gcattcttaaaagccattggttatttaattcctcttatggatgctgaatatgctaattat
tatactcgtgaagtaatgttaattcttattcgtgaattccagtcacctgatgaagaaatg
aagaagattgttcttaaagtggtgaaacaatgttgtggaacagatggtgtagaagcacaa
tatatcaaagatgaaatccttccacatttctttaaacacttttggaatcacagaatggct
ttagatcgtagaaattatagacaacttgtggatacaactgtagaaattgcaaataaagtt
ggcgcatcagaaattataaatcgcgtagtagatgatttgaaggatgaaaatgaacaatat
agaaaaatggttatggaaactattgaaaaaataatgggcaatttgggagcagcagatgtt
gattctcgtttggaagaacaacttattgatggtattttatatgcttttcaagaacaaaca
acagaggatgtagtaatgttgaatggttttggtaccattgtgaatacattaggaaaaaga
gtaaaagcatatcttccacaaatatgtggtacgatattatggagattaaataataaatct
gcaaaagtaagacaacaagctgccgacttaatatcacgaattgctgttgtgatgaagact
tgccaagaagaaaaactaatgggtcatttaggggttgttctttacgagtatttgggtgaa
gaatatccagaagtattaggtagtattttgggcgcattaaaagctattgtaaatgtcata
ggaatgacaaaaatgacaccacctattaaagatttattaccacgacttactcctatacta
aaaaatagacatgaaaaagtacaagaaaattgtattgatctcgtaggcagaattgcagat
agaggacctgaatacgtatctgctagagaatggatgagaatatgttttgaacttttggag
cttctaaaagctcataagaaagcgattagaagagctacagtaaatacatttggttatatt
gcaaaagcgataggtcctcatgatgtattagcaactttattaaataatttaaaagtacaa
gaacgtcaaaatcgagtatgcactacagtagctatagctattgtagctgaaacttgtagt
ccgtttacagtacttcctgcattgatgaatgaatatagagtaccagaattaaatgtacaa
aatggcgtattaaaatctttatcttttttgttcgaatatatcggtgaaatgggaaaagat
tatatatacgctgttagtccattgttggaagatgcacttatggatagagatttagtacat
agacaaacagcatgtgctgctattaaacatatggcattaggtgtttatgggtttggatgc
gaagatgcgttgatacatctattaaatcatgtatggccgaatgtttttgaaacttcacct
catttagtacaagcatttatggacgcagtagatggattacgtgtcgctcttggaccaatt
aaaatattacaatatactttgcagggattatttcatccagcacgaaaagtacgagatgta
tattggaaaatttataattctctttatataggtggacaagatgctcttgtagctggttat
cctcgaattatgaatgatccaaagaatcagtatattagatatgaattggactatgtttta
taa

DBGET integrated database retrieval system