KEGG   Apis mellifera (honey bee): 551363
Entry
551363            CDS       T01057                                 

Definition
(RefSeq) vesicle transport through interaction with t-SNAREs homolog 1A
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    551363
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ame04131]
    551363
Membrane trafficking [BR:ame04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    551363
SSDB
Motif
Pfam: V-SNARE V-SNARE_C Exonuc_VII_L Peptidase_M41 Sec20 DUF1664 DUF3958
Other DBs
NCBI-GeneID: 551363
NCBI-ProteinID: XP_006565092
BEEBASE: GB49903
UniProt: A0A088AEL5
AA seq 219 aa
MASLIDNYEQQYAVLTADITAKIGRIRTQNGSEKRAFIQDVDRQIEEAQELLEQMELEVR
GINGAARDRLRGRVESHRAELKRLTQEFHSAKKSKDESIEISREDSWENNITEDQKKRLL
DTSERIDRTGRTLQNGYRMVLETEEIGSQVLKELHEQRETIQRGRGRLRDTDAELGRGSR
LLSGIIFRSLQQRIILALVALTLIIVACIVMYYSFKSKS
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcgtcactcattgacaactatgagcaacaatacgccgttttgacagctgacattact
gcaaaaattggtagaataagaacacaaaacggcagtgagaaaagagcgttcattcaagat
gtggacagacaaatcgaggaagctcaagaattgcttgagcaaatggaattggaggttcgt
gggataaatggtgcagctcgcgaccgcttacgtggtcgagtagagagtcatagagcagaa
ttaaaacgattgacacaagaatttcattcagccaaaaaatcaaaagatgaaagtattgaa
ataagcagagaagattcatgggagaataatattacagaagatcagaaaaaaagattgtta
gatacctcagaacgaatagaccgtacaggaagaactttacaaaatggatatcgtatggta
ttagaaacagaagaaattggttcccaagtattgaaagaattacatgagcaaagagaaaca
attcaaaggggaagaggaagattaagagacacagatgcagaattgggtcgtggttcacgt
ttactctcaggaatcatttttagaagccttcagcaaagaattattttagcattagtagca
ttaacgcttataattgttgcttgtattgtcatgtattatagctttaaatctaaaagctaa

DBGET integrated database retrieval system