KEGG   Apis mellifera (honey bee): 551371
Entry
551371            CDS       T01057                                 

Definition
(RefSeq) DET1 homolog
  KO
K10571  de-etiolated-1
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    551371
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ame04121]
    551371
Ubiquitin system [BR:ame04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     551371
SSDB
Motif
Pfam: Det1
Other DBs
NCBI-GeneID: 551371
NCBI-ProteinID: XP_623769
BEEBASE: GB42382
UniProt: A0A087ZU69
AA seq 555 aa
MAEKEAKIEYVTEPCPIKPRKIGPQNIILRLKRRETFGCPYPGTHVHCARQFYQNVFPNF
TVMNVEKPPCFLRKFSPDGHYLIAFSSDQTSIEVYEYRGASAAADLLANSEGEYIGHKND
ECSFQIRRNIFNRFFKAKWIVNVVQSNEQLNRECSLFTDDGRYVIVGSAAHIPDELRPHF
YQIYSNNEALTPNPRSPLEDYSLHLVDLHGGKLCDTRHFKVDKIYLSHNQGLYLYKDILA
VLSVQHQTIHIFQILDGMFINVRTIGRFCLEDDAYLVRSACPGVNCRPFRDVTINCLKHK
LLVYLYKRAAYISDTTKDPYELRRFYQYFDQLNALRMWKMQLLDTNHILVRFASEEVATL
QANEPNVQPALLVVYDMVTAKILAAYDNTSTQLLTQFENFSDFFRNARMNGDCQYMCSPS
NNIYARLLQQRFKQTIISARYGGVTEATKRLLAQLPICAQSYSSSPYLDLSLFCYDDKWV
SMMERPKACGEHPIRFYARDSGLLKFRMYAGMLGRTTPTAARRLVAFTFHPTDPFAISVQ
RTNAEYIVSFHVRHV
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggcagaaaaggaggctaagattgaatacgtgacagaaccttgccctattaaacctcgt
aaaataggtccacagaatataatattacgtttaaagcgtcgagaaacatttggttgtcct
tatccagggacacatgtacactgtgctagacaattttatcaaaatgtatttccaaatttc
actgttatgaatgtggagaaacctccatgttttcttagaaaatttagtcctgatggtcat
tatttaattgcatttagttctgatcaaacttctatagaagtttatgaatatcgtggtgca
tctgcagctgctgatttgctagcaaattcagaaggtgaatatattggtcataagaatgat
gaatgcagtttccaaattagaagaaacatttttaatagattttttaaggctaaatggatt
gttaatgtggttcaaagtaatgaacaattgaatagagaatgtagtttatttacagatgat
ggtcggtatgtaattgttggttcagctgctcatattccagatgaattgagaccacatttc
tatcaaatttattctaacaatgaagcactgactccaaatcctagatcaccacttgaagat
tatagtttacatcttgttgatttacatggaggaaaattatgtgatactagacattttaaa
gtagataaaatatatttatctcataatcaaggcctctatctttataaagatatattggca
gtattatcagtacagcatcaaactattcatatatttcaaattcttgatggaatgtttatc
aatgttagaacaataggaagattttgtttagaggatgatgcttatttggttagaagtgca
tgtcctggagtaaactgtcgcccatttagagatgttacaataaattgtctcaaacataaa
ttattagtttatttgtataaaagagcagcatatattagtgatacaacaaaagatccatat
gaattaagacgtttttatcaatattttgaccaattaaatgcattacgaatgtggaaaatg
cagttattagatacaaatcatattcttgtaagatttgcaagtgaagaagtagcaactctt
caagcaaatgaacctaatgtacaacctgcacttttagtagtctatgatatggttactgcc
aaaatattagctgcatatgataacacatctacccaattattaacacaatttgaaaatttc
agtgattttttcaggaatgctagaatgaatggtgattgtcaatatatgtgttccccatct
aacaatatatatgcaagattgttacaacagagatttaaacaaacaataataagtgccaga
tatggtggtgttactgaagctacaaaaagattacttgctcaattgccaatatgcgctcaa
tcttattctagttctccatatctggatttgtctttattttgttatgatgataaatgggta
tctatgatggagcgtcctaaagcttgcggcgagcatcctatacggttttatgctcgtgat
tctggtcttctaaaatttcgaatgtatgcgggaatgttaggtcgtaccacacctacagct
gcaagacgtttagttgcatttacctttcatccaacagatccatttgctatttctgttcaa
cgaacgaatgctgaatacatcgtcagttttcatgttagacatgtttaa

DBGET integrated database retrieval system