KEGG   Apis mellifera (honey bee): 551386
Entry
551386            CDS       T01057                                 

Name
(RefSeq) 26S proteasome regulatory subunit 10B
  KO
K03064  26S proteasome regulatory subunit T4
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03050  Proteasome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    551386
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ame03051]
    551386
Proteasome [BR:ame03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     551386
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_16 AAA_22 AAA_2 AAA_5 RuvB_N AAA_33 DUF815 AAA_7 AAA_18 AAA_14 AAA_11 RNA_helicase Prot_ATP_OB_N AAA_3 Mg_chelatase DUF5906 ATPase_2 TIP49 TsaE bpMoxR TPR_MLP1_2 AAA_25 AAA_30 AAA_24 ATPase NACHT AAA_28 Sigma54_activat IstB_IS21
Other DBs
NCBI-GeneID: 551386
NCBI-ProteinID: XP_006571393
BEEBASE: GB51586
UniProt: A0A7M7H4R2
Position
LG1:22779329..22781292
AA seq 393 aa
MATTVDSVREKALQDYRKKLIEHKEVESRLKEMREHLKDLTKQYDKSESDLKALQSVGQI
VGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKNKLKSGTRVALDMTTLTIMRYLPREVD
PLVYNMSHEDPGDVTYSAIGGLSEQIRELREVIELPLLNPELFQRVGITPPKGCLLYGPP
GTGKTLLARAVASQLDANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEID
AIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLD
RKIEIPLPNEQARLEILKIHAGPISKHGEIDYEAVVKLSDGFNGADLRNVCTEAGLFAIR
LEREYVIQEDFMKAVRKVSDNKKLESKLDYKPV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggcaaccaccgtggattcggttagggaaaaagcccttcaagattatagaaaaaagctt
atagaacataaagaagtagaatcacgtttaaaggaaatgagagaacatcttaaagactta
acaaaacaatatgataaatctgagagtgatttaaaagctttacaaagtgttggacagatt
gttggagaagtattaaaacaacttactgaagaaaaatttatagtaaaagcaacaaatggt
ccacgttatgttgttggatgtcgacgtcaacttgacaaaaataaattgaaatctgggaca
agagtagctcttgatatgactactcttactataatgcgttatttacctcgtgaggttgat
ccattggtttataacatgtcacatgaagatcctggtgatgttacatatagtgcaattggt
ggtctaagtgaacaaatacgagagctaagagaagttatagaattaccattattaaatcct
gaattatttcaaagagttggtataactcctcccaaaggatgtctcttatatggaccacca
ggaactggaaaaacattattagccagagcagttgctagtcaattagatgcaaatttttta
aaagttgtatcaagtgctattgttgataaatatattggtgaatcagcaagattgattaga
gaaatgtttaattatgcacgagatcatcaaccgtgtatcatatttatggatgaaattgat
gcaattggtgggcgtagattttcagaaggtacaagtgctgatcgtgaaattcaaagaact
ttaatggaattattaaatcaaatggatggttttgattctttaggccaagttaaaatgata
atggctacaaatagaccagatactttggatccagctttattaaggccaggtagattagat
agaaaaattgaaatcccattacctaatgaacaagcacgtctagaaattttaaaaattcat
gctggtcctatatctaagcatggagaaattgattatgaagcagtagtcaaactttcggat
ggatttaatggtgctgatttaagaaatgtttgcactgaagcaggattatttgcaataaga
ttagaaagagaatatgtaatacaagaagattttatgaaggcagtaaggaaagtttcggat
aataaaaaacttgaatccaaattagattacaaacccgtataa

DBGET integrated database retrieval system