KEGG   Apis mellifera (honey bee): 551437
Entry
551437            CDS       T01057                                 
Name
(RefSeq) alpha-N-acetylglucosaminidase isoform X2
  KO
K01205  alpha-N-acetylglucosaminidase [EC:3.2.1.50]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00531  Glycosaminoglycan degradation
ame01100  Metabolic pathways
ame04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    551437
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    551437
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ame04147]
    551437
Enzymes [BR:ame01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.50  alpha-N-acetylglucosaminidase
     551437
Exosome [BR:ame04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   551437
SSDB
Motif
Pfam: NAGLU NAGLU_C NAGLU_N
Other DBs
NCBI-GeneID: 551437
NCBI-ProteinID: XP_006559874
BEEBASE: GB42551
UniProt: A0A7M7GMW2
Position
LG7:complement(2082573..2089958)
AA seq 773 aa
MLIYSLLVSIVFFLSGSLTVFCNDTNSNVFQNTLSHIRPRISSEEQANAAAGVVERLLGP
ERAKNFVMMVNPNFTSPGKDSFLIKKNSMGQVEILGTSGVVAAWGLHYYLKTYCNVHISW
EGNQVELPDILPDVRVKISSNDRFRYYQNVCTLGYTSAWWQWEDWEKNIDWMALNGINLA
LAFTGQEAIWQKVYLRLNFTMEEINEHFGGPGFLPWSRMGNMRGFGGPLNSNWHDKSIRL
QHRILERMRALGIIPVLPAFAGHVPRALLKLFPKANVTKSAVWNNFSDKYCCPYLLEPTD
PLFKQIGQQFLKTYIEEFGTDHVYNCDTFNENEPYTSELKFLRNIGHSIFEAMNSVDSKA
IWLMQGWLFYHDSVFWTEPRTRTFLTSVPLGRMIVLDLQSEQFPQYKRLNSYYGQPFIWC
MLHNFGGTLGMFGSAEIINHRVFEARNMNGSTMVGTGLTPEGINQNYVIYELMNEMAYRK
KPVNLDKWFENFANRRYGDIKGNEHTVTAWKGFKNTVYNFSDTRRIRGKYVITIRPNLNF
FPWRWYNKDAFIYYWYVLLQARDLKRNSTLYRHDVVDVTRQALQLIADEIYTDLIESFNK
KNIDLFKQNAKLLLALFDDLEEILASSEDFLLGKWLKMAKDLATDDEEEILYEYNARNQI
TLWGPLGEIRDYANKQWSGIVADYFKPRWAIFLNELETSLTTGTRVNTTRINKRIFENVE
KAFTFSRKIYPTKATGDSIDIAERILSEWYDPHLPFHKTSRHNYKQYWSNSYY
NT seq 2322 nt   +upstreamnt  +downstreamnt
atgttaatctactcgttactcgtgtcaatagttttttttctttctggatctttaacagtt
ttctgtaacgatacgaattcaaatgtatttcagaatactctaagtcacattaggcctcgg
atttcatcggaagaacaagctaatgcagcagcaggtgtcgttgaaagattattgggacct
gaacgtgctaaaaatttcgtaatgatggtgaatcctaattttacttctcctggaaaagat
tcttttttgataaagaaaaattccatgggtcaagtcgaaatccttggcacttccggtgtg
gttgcagcctggggtctgcactattacctcaaaacctattgcaacgttcacatttcatgg
gaagggaatcaagtcgaacttcctgatatcttgcctgatgttcgtgtaaaaatcagctct
aacgatagatttagatattatcagaatgtgtgcactctgggttatacttctgcatggtgg
cagtgggaagattgggaaaaaaatatcgattggatggcccttaatgggatcaatttggcg
cttgcttttactggacaagaagctatctggcagaaagtctatcttcgattgaatttcact
atggaggagatcaatgaacattttggagggccaggatttttaccatggtctagaatgggt
aatatgcgaggatttggaggacctttaaactcgaattggcacgataaatcgattcgattg
cagcatcgaattcttgagaggatgagggcgttaggaattatacctgttttgcctgctttc
gcgggtcacgtgcctagagccctcctcaagctatttccaaaagctaatgtaaccaaaagt
gcggtttggaataacttctcagataaatattgttgcccttatctcttggagcctacagat
cctctgttcaaacaaattgggcaacaatttttaaaaacatatatcgaagaatttgggact
gatcatgtttacaactgcgacactttcaatgaaaacgaaccctacaccagtgaactcaaa
tttctgaggaacatagggcattcaattttcgaagctatgaacagcgttgactcaaaagcg
atatggttaatgcaaggatggttgttttatcatgattcagttttctggacagagccgaga
actcgaacatttttaacttcagtcccattgggaagaatgatagtactggatcttcaatca
gaacaatttccacaatacaagagattaaattcttattatggtcagccatttatctggtgc
atgttgcacaactttggtggcacccttggaatgtttggttccgctgaaattattaatcat
cgagttttcgaagctagaaatatgaatggcagtacaatggtcgggacaggtctaacacca
gaaggtataaaccaaaattacgtcatctacgagttgatgaacgagatggcttatcgtaag
aaacccgtcaacttggataaatggttcgaaaattttgccaatcgaagatacggcgatatc
aaagggaacgagcacactgttacagcatggaaaggttttaagaacacggtgtataatttc
tcggacaccaggagaattagggggaaatacgtgatcaccattcgaccaaacttaaatttc
tttccatggagatggtataataaagatgcatttatctactactggtacgtgttgctacaa
gcgagagacttgaaacggaatagcaccctttatcgacacgatgttgttgacgttaccagg
caggcacttcaactgatagctgatgaaatttatactgatttgatagaatcgttcaataag
aagaatatagatctgttcaaacaaaatgccaaactgttgttggcgctgttcgacgatctc
gaggagattttagcatcgagtgaagattttctgttaggaaaatggttgaagatggcgaaa
gatttggccactgacgatgaagaagagatattgtacgagtacaacgcgagaaatcagatt
acattgtgggggccactaggggagataagggattatgcaaataaacaatggtcaggaatt
gtggcggattatttcaagccccgttgggctattttcttgaacgaacttgaaacgagtttg
accactggaaccagagtgaatacgacgagaattaacaaacggatattcgaaaatgttgag
aaagcttttacgttctctagaaaaatttatccaacgaaagcaacaggtgattcgatcgat
atagctgaaagaatcctatccgaatggtacgatccacatcttcctttccataaaacttct
cgtcataactataaacagtattggtcgaattcttattactaa

DBGET integrated database retrieval system