KEGG   Apis mellifera (honey bee): 551470
Entry
551470            CDS       T01057                                 

Definition
(RefSeq) general transcription factor IIF subunit 2
  KO
K03139  transcription initiation factor TFIIF subunit beta [EC:3.6.4.12]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    551470
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ame03021]
    551470
Enzymes [BR:ame01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     551470
Transcription machinery [BR:ame03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIF
     551470
SSDB
Motif
Pfam: TFIIF_beta TFIIF_beta_N
Other DBs
NCBI-GeneID: 551470
NCBI-ProteinID: XP_623868
BEEBASE: GB50872
AA seq 271 aa
MSANVSHTEKELDLSNAGRGVWLVKVPKYIANKWEKAPGNIEVGKLKITKNPGQKAEVSL
RLSEAVLALKEPGEEEIPKQHRLDVTTVTKQMLGVFSHVTPSSSSDSIVPETEKLYMEGR
IVQKLECRPYADNCYMKLKLQSIKRASVPQRQVQQLDRVVQNFKPVSDHKHNIEYAEKKK
AEGKKMRDDKDAVLDMLFAAFEKHQYYNIRDLVKITRQPIVYLKEILNEVCNYNLKNPHR
NMWELKPEYRHYKEEEKLEDMQKKIDESDDD
NT seq 816 nt   +upstreamnt  +downstreamnt
atgtctgcgaatgtgtcacatacagaaaaagaattagatttaagtaatgcaggcagaggt
gtatggcttgtgaaagtacctaaatatatagcaaataaatgggaaaaagcacctggcaat
atagaagttggtaaattaaagataactaaaaatcctggtcaaaaagcagaagtatctctt
agattatctgaagctgttttagctttaaaagaacctggagaggaagaaattccaaaacaa
catagattagatgttacaacagtaacaaaacaaatgttaggtgtattttctcatgttacc
ccttcaagtagttcagattctatagttcctgaaactgaaaaactttatatggaaggaaga
attgtacaaaaattagaatgtcgtccatatgctgataattgttatatgaaattaaaatta
caaagcattaaaagggcttctgtaccacaaagacaagttcagcaattagatagagtagtc
caaaatttcaaaccagtttctgatcataagcataatattgaatatgcagaaaagaaaaag
gcagagggtaagaaaatgagagatgataaagatgcagtattggatatgttatttgctgca
tttgaaaaacatcaatattataacataagagatcttgtgaagattacaagacaacctatt
gtatatctaaaagaaatattaaatgaagtttgtaattataatttgaaaaatcctcacaga
aacatgtgggagttaaaaccagaatatcggcattataaagaagaagaaaaacttgaagat
atgcaaaaaaaaattgatgaatcagatgatgattaa

DBGET integrated database retrieval system