KEGG   Apis mellifera (honey bee): 551511
Entry
551511            CDS       T01057                                 
Name
(RefSeq) elongin-B
  KO
K03873  elongin-B
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    551511
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ame04121]
    551511
   03400 DNA repair and recombination proteins [BR:ame03400]
    551511
Ubiquitin system [BR:ame04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul2 complex
    Adoptor protein
     551511
   Cul5 complex
     551511
DNA repair and recombination proteins [BR:ame03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     551511
SSDB
Motif
Pfam: ubiquitin DUF4373
Other DBs
NCBI-GeneID: 551511
NCBI-ProteinID: XP_623908
BEEBASE: GB53171
UniProt: A0A7M7TFQ0 A0A8B9B440
Position
LG4:complement(2836827..2839141)
AA seq 117 aa
MDVFLMIRRKNMTIFTDAKDNTTVLELKKIIEGILKISPVNQQLFNKDNVLMSDSKFLSD
YGLTSATAKPQCPALVGLAIRQDNGQFEPLEMTPFSLPPDLPDVMKSQETNGQEQSP
NT seq 354 nt   +upstreamnt  +downstreamnt
atggatgtatttctaatgattcgacgaaaaaatatgacaatatttactgatgccaaggat
aatactacagttcttgagcttaaaaaaattatagaaggtattttgaaaatatcacctgtg
aatcaacagctgttcaacaaggataatgttcttatgtcagatagtaaatttttatctgat
tatggattaacatcagcaactgcaaaaccacaatgtcctgcattagtaggattagctata
cgtcaagataatggtcaattcgaacctttagagatgacaccattttcattaccacctgat
ttaccagatgttatgaaatctcaagaaactaatggacaagaacaatcaccttga

DBGET integrated database retrieval system