KEGG   Apis mellifera (honey bee): 551578Help
Entry
551578            CDS       T01057                                 

Definition
(RefSeq) protein O-mannosyl-transferase 2
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00514  Other types of O-glycan biosynthesis
ame00515  Mannose type O-glycan biosynthesis
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    551578
   00514 Other types of O-glycan biosynthesis
    551578
Enzymes [BR:ame01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     551578
Glycosyltransferases [BR:ame01003]
 O-Glycan biosynthesis
  O-linked Man type
   551578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMT PMT_4TMC MIR
Motif
Other DBs
NCBI-GeneID: 551578
NCBI-ProteinID: XP_006564834
BEEBASE: GB48677
Position
LG5
AA seq 694 aa AA seqDB search
MKNISNSECTHKIKNLHKISKVTEKRETIDLNWWLLFGIIIILTAGTRFYKVTEPQHVCW
DETHFGKMGSWYINRTFFFDVHPPLGKMLIALSGYVTGYDGTFPFEKPGDKFENVKYVGM
RIFCTFLGATIVPLSYLIIWDLTKSIQAATFSALFILFDVGLLTLNQYILLDPILLCFMM
CAIWGMTRVGSHYNEPFTWKWWGWLLFTGISLACTISVKFVGLFVVLLVGFNTAFELWRE
LGDLTKPIINVGKHLLARCICLIFIPIFLYMLFFYIHLTVLNKSGSGDGFYSSEFQSLLE
GNSLYNATMPRQLAYGATITLKNHRTGGGYLHSHWHLYPEGIGARQQQITTYSHKDDNNL
WLIKMFDTDDIPSEPILVKHGDLVRLEHVITHRNLHSHKEIAPISKKHYQVTGYGENGTG
DANDVWKVLIANGKDGDVVETVTSKLKFVHCLYHCVLTCSGKTLPKWAYSQQEVSCNPNM
RDKNALWNIEDNNYAKLPNVSFQVYAPRFLDRFLESHAVMLQGNSDLKVKEGEVSSRPWQ
WPINYRGQFFSGNSLRIYLLGNPIIWWGNIIFLILFIILYIHACVRQQRGCIESPAILEQ
RNKILNAGKWLFIGWILHYAPFWAMTRVLYFHHYFPALLYSSMLSGTTLNYILESLIILF
PNKLGYVIYHTIMAIVISSITYSLWYDWSFFIRS
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatataagtaattctgaatgtacacacaaaataaaaaatttacataagatatct
aaagttacagaaaaaagggaaacaatcgatttgaattggtggcttttatttggaattatt
ataatactcacagcaggaacaagattttataaagttacagaaccacaacatgtttgttgg
gatgagactcattttggtaaaatgggaagttggtatataaatagaacatttttctttgat
gttcatccacctcttggaaagatgttaatagcattatctggatatgtaactggttatgat
ggaacatttccctttgaaaaaccaggagataaatttgaaaatgttaaatatgttggtatg
agaattttttgtacatttttgggtgcaactatagttcctttatcgtatcttattatatgg
gacttaacaaaatctattcaagcagcaacattttctgcattatttatattgtttgatgtg
ggattattgacattaaatcaatatattttattggatcctatattattatgttttatgatg
tgtgcaatttggggcatgacccgtgtaggttctcattataatgaaccatttacatggaaa
tggtggggttggttattattcacaggaatttctcttgcttgtacaattagtgtaaaattt
gttggtttgtttgttgttttgttagttggatttaatactgcttttgaattatggagagaa
ttaggagatctcacaaaacctattataaatgtaggaaaacatttattagcacgatgtatt
tgtctaatttttataccaatatttttgtacatgttattcttttatattcatcttactgtt
ttaaataaaagtggaagtggagatggattttatagttctgagtttcaatctttattagaa
ggaaattccttatataatgcaacaatgccacgacaattagcatatggagctacaattact
ttaaaaaaccatagaactggtggaggatatttacattctcattggcatctttatccagaa
ggcattggagctagacaacaacaaattacgacttattctcataaagatgataataatttg
tggcttataaaaatgtttgatactgacgatataccgtcggaaccgatattagtaaagcat
ggtgatcttgtacgcttagaacatgttattactcatcgaaatttgcattcacataaagag
attgcacctatttctaaaaaacattatcaagttacaggatatggtgaaaatggtactggt
gatgctaatgatgtatggaaagttttaatagcaaatggtaaagatggtgatgtagttgaa
acagtgacaagtaaattaaaatttgtgcattgtctatatcactgtgttttaacatgcagt
ggtaaaacattaccaaaatgggcttatagtcaacaagaagtttcatgtaatccaaatatg
agagacaaaaatgcattatggaatattgaagataataattatgcaaaattaccaaatgtc
agctttcaagtatatgcacctagatttttagataggtttttggaatcacatgcagtaatg
ttgcaaggaaattctgatttgaaagttaaagaaggagaagtatcatcacgtccttggcag
tggcctattaattatagaggtcaattcttttctggtaacagtttaaggatatatttactt
ggaaatcctattatttggtggggtaatattatatttttaatactttttatcatattatac
attcatgcttgcgtaaggcaacaacgtggttgtatagagagtcctgctatccttgaacaa
agaaataaaatattaaatgcaggaaaatggctttttattggttggatattgcattatgca
ccattttgggcaatgactagagttttatattttcatcattatttcccagctctattatat
agttcaatgttaagtggaacaactttaaattatattcttgaaagtttaattattttattt
ccaaacaaacttggatatgttatatatcatacaataatggctattgttatttcaagtatc
acatatagcttatggtatgattggtccttcttcattagatcctga

DBGET integrated database retrieval system