KEGG   Apis mellifera (honey bee): 551677
Entry
551677            CDS       T01057                                 
Name
(RefSeq) wee1-like protein kinase
  KO
K06632  wee1-like protein kinase [EC:2.7.11.1]
Organism
ame  Apis mellifera (honey bee)
Brite
KEGG Orthology (KO) [BR:ame00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ame01001]
    551677
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ame03400]
    551677
Enzymes [BR:ame01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     551677
Protein kinases [BR:ame01001]
 Serine/threonine kinases: Other
  WEE family
   551677
DNA repair and recombination proteins [BR:ame03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    551677
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pox_ser-thr_kin DUF6083 Kdo
Other DBs
NCBI-GeneID: 551677
NCBI-ProteinID: XP_006560863
BEEBASE: GB53607
UniProt: A0A8B6YUY6 A0A7M7GS96
Position
LG12:complement(3859319..3868654)
AA seq 589 aa
MEVAQKLHFDACDIQDEELNISCRTNSSGCDVDDILDSSAEDLGCSPPLQPRKLSFSNTM
DCSDSENNQSVPINNNKTPISNMTGTSRIRIPPRENICSQKISMACSPPYKRVRALRLFD
SPATPKTLMEKSAMHTPFPSKCTRLFSLDKSRSCNYQNKSDKPTANVNPFTPNGMLLTAR
KRTRSKRSLNGSPDIQIPKFDLADSEDSDNEIEQATKRVALQDSNILRYHQEFHELGLIG
TGEFGSVYKCINRLDGCTYAIKKSIKPVAGSINEKNALNEVYAHAVLGKHQHVVRYYSAW
AEDNHMIIQNEYCNGGSLADAIINLEKEKKHFTEAEMRQLLLHVAEGLRYIHSMQLVHMD
IKPGNIFISKEKRLLAVNYDSADDGFDEEETIEEEITYKIGDLGHVTSVNNPQVEEGDCR
YLPTEILREDFSHLPKADIFAFGLTVYEAGGGGPLPKNGPEWHDIRNGNLKELSHYSRDL
NELLKLMIHPNPEMRPSAICLIQHRVLCPFGNKTKAQLRRELNAEKLKNEILSKQLQEAA
KCLKTIAPNVAAINNTMNAGGYKLRPTPTRTSSRAVGKKVNRSNSTTNF
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggaagttgcacaaaagttgcatttcgacgcatgcgatattcaggacgaggagctaaac
attagctgtcgtacaaatagctccggttgtgatgttgacgatattttagattcttcagca
gaagatcttggatgttcacccccacttcaaccaagaaaattatcatttagtaatacaatg
gactgtagtgacagtgaaaataatcaatctgtgccaattaataacaataagacgccgatc
agtaacatgacaggtacatcaagaattagaattccacctcgtgaaaacatatgttctcaa
aaaatatcaatggcatgtagtccaccttataaacgtgttagagctttacgtctatttgat
tctcctgctactccaaagacattaatggaaaagagtgcaatgcatactccatttccatct
aaatgtactagactattttcattagacaaatctagatcatgtaattatcaaaataaatct
gacaaacctactgctaatgtaaatccttttacaccaaatggaatgttgttaactgcaaga
aaacgcactagatctaaacgtagtcttaatggatctccagatattcaaataccaaaattc
gatctcgccgattctgaagattctgataacgaaatagaacaagctacaaaacgtgttgca
ttgcaagattcgaatattttacgatatcatcaagagttccatgaacttggtttaattgga
acaggtgaatttggttcagtttataaatgtattaaccgattagatggatgcacttatgct
attaaaaaaagtattaaaccagttgctggaagtattaatgaaaagaatgccttaaatgaa
gtgtatgcgcatgctgtacttggtaaacatcaacatgttgtgagatattattctgcatgg
gcagaagataatcatatgataattcaaaatgaatattgtaatggtggcagtttagcagat
gcaattatcaatttagaaaaggaaaaaaaacatttcactgaagcagaaatgcgacaattg
ttgttacatgttgctgaaggtttaagatatattcacagtatgcaattagtacacatggat
attaaacctggaaacatatttatttccaaagaaaagaggttactcgcagttaattatgat
tcagctgatgatggtttcgacgaagaggaaactatcgaagaagaaattacttataaaata
ggagatttgggtcatgttacatccgttaataatcctcaagttgaagaaggagattgtaga
tatttgccaacagaaattttacgcgaagattttagtcatttaccaaaagctgatattttt
gcttttggattaactgtttatgaagcaggtggtggaggtccactacctaaaaatggacca
gaatggcatgatattagaaatggaaatttaaaggaattatcccattatagccgtgatctt
aatgaattacttaaattaatgattcatccaaatcctgaaatgagaccatcagcaatttgt
cttatacagcatagagtattgtgcccatttggaaataaaacaaaagcacaacttcgacga
gaactgaatgcagaaaaattaaaaaatgaaattttgtcaaagcaactgcaagaagcggct
aagtgtttaaaaactattgctccaaatgtagcggctattaataatacaatgaatgcagga
ggctacaaactaagacctacaccaactagaacatcgtctcgagcagtgggtaaaaaagtc
aatagaagcaatagcactacaaacttttga

DBGET integrated database retrieval system