KEGG   Apis mellifera (honey bee): 551766
Entry
551766            CDS       T01057                                 

Definition
(RefSeq) ATP synthase subunit beta, mitochondrial
  KO
K02133  F-type H+-transporting ATPase subunit beta [EC:7.1.2.2]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00190  Oxidative phosphorylation
ame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ame00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    551766
Enzymes [BR:ame01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     551766
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N ATPase_2 NB-ARC RsgA_GTPase ATPase AAA_19 DUF2075 AAA_16
Other DBs
NCBI-GeneID: 551766
NCBI-ProteinID: XP_006564892
BEEBASE: GB52736
UniProt: A0A088AMB8
AA seq 516 aa
MLNVVSKAAAGALRAVKPSILQNEITKISGALSVNSRDYAKAASSKGGAQGKIVAVIGAV
VDVQFDDALPPILNALEVQNRTPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQSVLDSGY
PIRIPVGAETLGRIINVIGEPIDERGPIPTDKLAPIHADAPEFVDMSVEQEILVTGIKVV
DLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEM
IESGVISLKDKTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFR
FTQAGSEVSALLGRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDP
APATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIIGAEHYNVARGVQKILQD
YKSLQDIIAILGMDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHAGKLVPLEETIKG
FKKILAGDYDHLPEVAFYMVGPIEEVVAKAESLAKQ
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgttgaatgtcgtatcgaaagctgccgctggcgccttaagggccgtcaagccttctatc
cttcaaaatgaaattaccaaaatttcgggagcattatcagtaaatagtagagattatgca
aaagctgcaagctccaaaggtggagctcaaggaaaaattgttgctgtcattggtgcagtt
gttgatgtacaatttgatgatgctcttcctccaattcttaatgctttggaagtacaaaat
cgcactcccaggctagtccttgaagtagcacagcatttgggagaaaacacagtacgcact
attgctatggatggtactgagggtcttgttcgtggacaaagtgttctggattctggatat
cctattcgtattcctgttggtgctgagacattgggacgcattattaatgttattggtgaa
ccaattgatgaacgtggacctattcctactgataaacttgctcctatccatgctgatgct
ccagaattcgtagatatgtctgttgaacaggaaattttagtaactggaataaaagttgtt
gatcttcttgctccttatgctaaaggaggaaaaataggtctatttggaggtgctggtgtc
ggaaaaactgtattaattatggaattaatcaataatgtagcaaaagcccatggtggttat
tctgtatttgctggtgtgggtgaacgtactcgtgaaggaaatgatttatatcatgaaatg
attgaatctggagtcatttcattgaaagataaaacttccaaggtagctctggtatatggt
caaatgaacgaacctccaggtgcacgtgctcgtgtcgctttaactggcttaaccgttgcc
gaatatttccgtgatcaagaaggacaggatgtattactattcattgataatatctttagg
tttactcaagctggttctgaagtatcagctttgttaggtcgtatcccatctgctgtaggt
tatcagccaacattagcaactgatatgggtagtatgcaggaacgaattacaacaacaaaa
aaaggatctattacttctgtgcaagctatttatgtacctgctgatgatttgacagatcct
gcgcctgccactacctttgctcatttagacgctacaactgtattgtctcgagctattgct
gaattaggtatctatcctgctgtcgatccccttgattccacttctcgtatcatggatcct
aatataattggtgctgaacattataatgttgctcgtggcgtacagaaaatcttacaggat
tacaaatcacttcaagatattattgctatcttaggtatggatgaattatcagaagaagat
aaactcactgttgcacgtgcacgtaaaattcagaggttcttgtctcaaccattccaggtt
gctgaggtatttactggtcacgctggtaaattagtaccattagaagaaactattaaagga
tttaagaaaattcttgctggagattatgatcatttgccagaagttgcattctacatggtc
ggtccaatcgaagaagtagtagcaaaagcagaatcattggcaaaacaataa

DBGET integrated database retrieval system