KEGG   Apis mellifera (honey bee): 551966Help
Entry
551966            CDS       T01057                                 

Gene name
ade5
Definition
(RefSeq) multifunctional protein ADE2
  KO
K01587  phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame00230  Purine metabolism
ame01100  Metabolic pathways
Module
ame_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:ame00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    551966 (ade5)
Enzymes [BR:ame01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     551966 (ade5)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     551966 (ade5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAICAR_synt AIRC
Motif
Other DBs
NCBI-GeneID: 551966
NCBI-ProteinID: XP_624351
BEEBASE: GB52251
UniProt: A0A088AL04
Position
Un
AA seq 420 aa AA seqDB search
MDKYKYGKLIIEGKTKKVYEVLNDSTLCLLQSKDCITAEDGKKFHNLKGKAAISTATTAK
VFQLLNKAGIKTAFVELVNDTVFVAQKCQMVPIEWVTRRLATGSFLKRYQGVPEGYRFNP
PLQETFFKDDINHDPQWSEEQIISAGFKLNELVIGKDEFDIMQHIALTVFEILERTWASR
DCALIDMKIEFGVNVNNEIMVADIIDSDSWRLWPFGDKRLMKDKQVYRNLDIVTEEDLNT
IKCNFKWIQDQLDHLLPLSSSLVVILMGSLSDESHCKEIAKHAKSLGLKVQFRVCSAHKG
TQETLRILAEYEGTYEKIVLIAVAGRSNGLGPVLSGNTSLPVINCPPFKPENISQDLWSS
INVPSGIGCTTVIYPESAALAAAQIHALHNHLVWACLRVKQLKNYIALKQADINLKNLIV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggataaatataaatatggaaaactcattattgaaggaaagaccaaaaaggtatatgaa
gttctaaatgattctactttgtgtcttttacaaagtaaggattgtattactgctgaagat
ggtaaaaaatttcataatttaaaaggaaaagctgcaattagtacagctactacagctaaa
gtatttcaattattaaataaagctggaataaaaacagcttttgttgaattggtaaatgat
actgtttttgttgcccaaaagtgtcaaatggtaccaattgaatgggttactcgaagatta
gccactggtagttttttaaaaagatatcaaggtgttcctgaaggttatagatttaatcca
cctttacaagaaacattttttaaagatgatattaatcatgatcctcaatggtcagaggaa
caaattatttctgctggttttaaattgaatgaactcgtaatagggaaagatgaatttgat
attatgcaacatattgcacttactgtatttgaaattttagaaagaacatgggctagtaga
gattgtgcacttatagatatgaaaatagaatttggtgtgaatgtaaataatgaaattatg
gtagcagatataattgatagtgattcttggagactttggccatttggtgataaaagatta
atgaaagataaacaggtatatagaaatttagatattgttactgaagaagatttgaacact
ataaaatgtaattttaaatggatacaagaccaacttgatcatcttcttcctttatctagt
agtcttgttgttattttaatgggatcactttctgatgaaagccattgtaaagaaatagca
aaacatgcaaaatctttaggtttaaaagttcaatttcgtgtatgtagtgctcataaaggt
actcaagaaacattgcgtattcttgcagaatatgaaggtacttatgaaaagatagtgtta
atagctgtagcagggagaagtaatggattaggtccagtcctttctggaaatacatctctg
cctgttattaattgtccacctttcaaaccagaaaatatttcccaagatttatggtcatcg
atcaatgttccatcaggaattggatgcaccacagtaatctatcctgaaagtgcagcatta
gcagctgctcaaattcatgcattgcataatcatttagtttgggcatgtttacgagtaaag
cagttaaaaaattatattgctttaaaacaagctgatattaatttaaagaatcttattgtg
taa

DBGET integrated database retrieval system