KEGG   Apis mellifera (honey bee): 552144
Entry
552144            CDS       T01057                                 
Name
(RefSeq) major facilitator superfamily domain-containing protein 8 isoform X2
  KO
K12307  MFS transporter, ceroid-lipofuscinosis neuronal protein 7
Organism
ame  Apis mellifera (honey bee)
Pathway
ame04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    552144
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ame02000]
    552144
Transporters [BR:ame02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Others
    552144
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 552144
NCBI-ProteinID: XP_006562864
BEEBASE: GB48380
UniProt: A0A8B6Z0Z0 A0A7M7GUC7
Position
LG10:6489703..6492217
AA seq 487 aa
MAWCKKLFHRRNNTFVDDDLETVFEKKERWRSIYVIYFTMFLMSLGFSIILTGVWPYLDK
LDSTAGKEYMGYVVAANPLGQMLFSPLVGWWGDKRGSIRLPLLSTLALFTFASGLYSILE
IVPGDRKMYMIVARFLVGVSSANIAVARSYLSAATKFVERTHAVSMVSLAQVLGFVVGPS
LQAAVTPLGEKERRIAIREAMRNEGKQTEEETLKSIKPDNLAAWTLICAFFVLVFNFVLL
ETLGTSLTMDQFAWSKTEALYYMGILMSIGAVVSCITFVMIEPLCKKFNERKVMLWGGFL
FMVIGRILCIPWGPGPPKIAYLESFNNITKDSNGTEIVGCPSTQEWCSYTPQLTPVQFFI
GYGFTTIGYPLGITLIQTIFSKVLGPRPQGVWMGFMTGAGCASRVLGPVFVSVIYTRFGT
YHTFGITGLTLIVCMSWLQIVNKRLVPPKAIILSKDMEIPLVHLKSNDIQDLNDAQKNNK
NEECDKM
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggcttggtgtaaaaaactatttcacagaagaaacaatacttttgtggatgatgatttg
gaaactgtttttgaaaaaaaagaacgatggagaagcatttatgtaatttattttaccatg
tttcttatgtctttgggttttagtattatattaacaggagtatggccatatcttgataag
ttggatagtactgctggtaaagaatacatgggatatgtagttgcagcaaatcctttaggg
caaatgttattttctcctctagtaggatggtggggagataaaagaggatctataagactt
ccacttttatcaacattagctttatttacatttgcatcaggattgtatagtatccttgag
attgtaccaggtgatcgaaaaatgtatatgatagttgccagatttttggttggagttagt
tctgctaatattgcagtagcacggtcttatctctcagcagctacaaaatttgtagaaagg
acacatgctgtttcaatggtatctcttgctcaggtattaggatttgtggtaggtcctagt
ttacaagctgcagttacacctcttggagaaaaggaacgtcgaattgctattcgcgaggca
atgcgaaatgaaggaaaacaaactgaggaagaaacattgaaatctataaaaccagacaat
ttagcagcctggacattaatttgtgcattttttgtcttagtatttaattttgttcttctt
gaaacacttggtacttctttaactatggatcaatttgcttggtcaaaaacagaagcttta
tattacatgggtatattaatgagtattggagctgttgtatcatgtatcacatttgttatg
attgaacctttgtgcaaaaaatttaatgaacgtaaggtaatgttatggggtggattttta
ttcatggtaataggaagaattttatgtattccatggggaccaggtcctccgaaaattgct
tatctggaatcatttaataatattacaaaagattccaatggcacagaaattgtaggatgt
ccaagtactcaggaatggtgtagctatacaccacaacttacacctgtacagttttttatt
ggatatggattcactactataggatatccattaggtattactctaatacaaactatcttc
agcaaagtattaggacctcgtccacaaggtgtttggatgggttttatgacaggtgctgga
tgcgcttctcgtgtcttaggtccagtatttgttagtgtaatttatactcgttttggaaca
tatcatacctttggtatcactggattaacattaatagtatgtatgtcatggttacaaatt
gtaaacaaacgactagttccaccaaaagcaataattctatcaaaagatatggaaattcca
ttagttcatctcaaatctaatgatattcaagatttaaatgatgcacaaaaaaacaataaa
aatgaggaatgtgataaaatgtag

DBGET integrated database retrieval system