KEGG   Apis mellifera (honey bee): 552445
Entry
552445            CDS       T01057                                 

Name
(RefSeq) 60S ribosomal protein L3
  KO
K02925  large subunit ribosomal protein L3e
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    552445
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ame03011]
    552445
Ribosome [BR:ame03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    552445
SSDB
Motif
Pfam: Ribosomal_L3
Other DBs
NCBI-GeneID: 552445
NCBI-ProteinID: XP_624821
BEEBASE: GB43559
UniProt: A0A7M7TG21
Position
LG14:complement(5020580..5025260)
AA seq 415 aa
MSHRKFSAPRHGSMGFYPKKRSQRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREA
DRPGSKVNKKEIVEAVTILETPPMIVVGVVGYIETPHGLRALTTVWAEHLSEDCRRRFYK
NWYKSKKKAFTKASKKWQDDLGRKSIENDFKKIIKYCKVVRIIAHTQMKLLRQRQKKAHI
MEIQLNGGTIEQKVQWAREHLEKPVPVSNVFAPDEMIDVIGVTKGKGYKGVTSRWHTKKL
PRKTHKGLRKVACIGAWHPSRVSFTVARAGQKGYHHRTEMNKKIYRIGQGIHTKDGKIVK
NNASTEYDLTEKTITPMGGFPHYGEVNNDFIMIKGCCMGPKKRVITLRKSLLVHTKRSAL
EKINLKFIDTSSKFGHGRFQTAADKTSFMGQLKKDRMREEQQAQATTSAPSAANA
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgtcgcacaggaagttcagtgcaccacgtcatggatctatgggattttatcccaaaaaa
agatctcaacggcatcgtggtaaagtaaaagcttttcctaaagatgatccaagcaaacct
gtacatttaacggcttttatcggttataaagccggtatgactcacgtagttagggaagct
gatcgtccaggatcaaaggtgaataagaaagaaattgtagaagcagttaccattttagaa
acaccacctatgattgtagttggtgtagttggttatattgaaactccgcatggtttacgt
gctcttactacagtatgggcagaacatttatctgaagattgtcgaagaagattttataaa
aactggtacaaaagcaaaaagaaggcatttacaaaagcttccaaaaaatggcaagatgat
cttggtcgtaaatctatagaaaacgattttaaaaaaatcattaaatattgtaaagttgta
cgaattatcgctcatacgcagatgaaattattaagacaacgtcaaaagaaagcccatata
atggaaattcaattaaatggtggaactattgagcagaaagttcaatgggctcgtgaacat
ttagaaaaaccagtacctgtcagtaatgtttttgctccagatgaaatgatagatgtaatt
ggtgtcacaaaaggaaaaggatataaaggtgttacatcgcgttggcatacaaaaaaattg
ccacgcaaaacacataaaggtctaagaaaagtcgcttgtattggagcttggcatcctagc
cgtgtgtcttttactgttgcacgtgctggtcaaaagggatatcatcatcgtacagaaatg
aataaaaaaatttatagaattggacaaggaattcatactaaagatggcaagatcgtaaag
aataatgcttctacagaatacgatcttaccgagaaaactataactcctatgggaggtttt
cctcattatggtgaagtaaataatgacttcattatgatcaaaggttgctgtatgggtccg
aaaaaacgtgtaattacattacgtaagtccttattagttcatactaaacgatcagcattg
gagaagatcaatcttaaatttatcgatacaagttccaaatttggacatggtcgttttcaa
actgctgctgataagacttcatttatgggtcaacttaaaaaagatcgtatgcgtgaggaa
caacaagcacaagctactacctcagcaccatcggccgcaaatgcttaa

DBGET integrated database retrieval system